KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2181Help
Entry
Rahaq2_2181       CDS       T01770                                 

Definition
(GenBank) aldose 1-epimerase-like enzyme
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00010  Glycolysis / Gluconeogenesis
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
raq01120  Microbial metabolism in diverse environments
raq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq2_2181
Enzymes [BR:raq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Rahaq2_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEX52039
UniProt: H2IYM8
Position
complement(2307416..2308285)
Genome map
AA seq 289 aa AA seqDB search
MTEQLFSLPVVNQISASVSQRLIDELPVLVVTHPKVRAAVALQGAHLLSWQPEGEEPVLW
MSSASAFKEGVAIRGGIPICWPWFGPAGKPSHGFARNVAWELTDHKETDDGVVLTLTLKN
SPETLELWPHAFTLTARFTLGATCHIELESTGDFEANSALHTYFNIGDIADVSIKGLGNS
FIDKVDGAKAKQEEGDLTFTGQTDRIYTQPQAISEIVDPVLKRTLVVAHENNADVVAWNP
GSALSVSMADMPDDGYKTMVCVETAQVSHTHKSTHAAPARLAVTFSIRK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaactcttttctcttccggtcgtaaaccaaatctctgcctccgtcagccag
cgtcttatcgacgaactgccggtgcttgtggtaacccatcctaaagtacgcgctgcggtt
gccctgcaaggcgcgcatttgctgtcatggcagcctgaaggcgaagaaccggtgctgtgg
atgagcagtgccagcgctttcaaagaaggcgtcgctattcgtggtggtatccctatttgc
tggccgtggtttggtcctgcgggcaaaccttcacacggctttgcgcgtaacgttgcgtgg
gaactgactgaccacaaagaaactgacgacggtgtggtactgaccttaacgctgaaaaat
tcccctgagaccctggaattatggccgcatgcgttcacactgacagcgcgcttcacgcta
ggcgccacctgccacatcgagctggaatctaccggtgatttcgaagccaacagcgccctg
cacacctatttcaacattggtgatatcgccgatgtcagtattaaaggtctgggtaacagc
tttattgataaagtcgatggcgcgaaagccaaacaggaagaaggtgatctgaccttcacg
ggccagactgaccgcatctacacccagccacaagcaatcagcgaaatcgttgacccggtt
ctgaaacgtacgctggttgtcgcgcatgaaaataacgccgatgtggtggcctggaatccg
ggttctgcactgtcggtgagcatggctgatatgccggatgacggatataaaaccatggtg
tgtgttgaaacggcgcaggtttcccacacgcataaatctacgcatgccgctccggcacgc
ctggcggtgactttctcaatccggaaataa

DBGET integrated database retrieval system