KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2185Help
Entry
Rahaq2_2185       CDS       T01770                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rahaq2_2185
Enzymes [BR:raq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Rahaq2_2185
    3.5.1.-  
     Rahaq2_2185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2310660..2311289)
Genome map
AA seq 209 aa AA seqDB search
MKSALLLVDLQNDFCRGGALAVTDGDATIAVANRMMTWCKSHDIPVLASQDWHPAGHRSF
AANSHAEPWTIGDLNGLPQVWWPVHCVQREPGAEFHPALHLPQVDFVVQKGTNPDIDSYS
AFFDNGHRAATVLNDWLKAAKITHLYVMGLATDYCVKFTVLDALELGYQVTLLTDGCRGV
NLHPEDSAEAVEAMRKAGAKISTSEAVTG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgcgttgttgctggttgatctgcaaaatgatttttgtcgcggcggcgcgctg
gcggtgactgacggcgatgccacgattgcggtcgccaaccggatgatgacatggtgtaaa
agccatgacatccccgtgctggcgtcgcaggactggcatccggccggacatcgcagcttt
gccgcaaattcccacgccgaaccctggacaatcggcgatctgaacggtttgccgcaagtc
tggtggccggttcactgcgttcagcgtgaaccgggggcagagtttcatccggcactgcac
ctgccgcaggtagactttgtggtacagaaaggcaccaacccggatatcgacagttacagc
gcctttttcgataacggtcaccgtgctgccactgtacttaatgactggctgaaagcggcg
aagatcacgcatttgtatgtgatggggctggcgacggattactgcgtgaagttcacggtg
ctggatgcgctggagttgggttatcaggtgacattacttaccgatggctgtcgtggcgta
aatctgcaccccgaagacagtgctgaagcggttgaagcgatgcgtaaagcaggggcaaaa
atcagtacatctgaggcagtaacaggctga

DBGET integrated database retrieval system