KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2227Help
Entry
Rahaq2_2227       CDS       T01770                                 

Definition
beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq2_2227
Enzymes [BR:raq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Rahaq2_2227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2357468..2358898
Genome map
AA seq 476 aa AA seqDB search
MAASAFPEGFLWGGAIAANQAEGGSFEGGKGLTTVDMIPHGAHRLAVKTGQEKRFSLKDD
EFYPAHQAIDFYHRYKEDIALMAEMGFTVFRTSIAWSRLYPNGDELVPNAEGIAFYRDVF
AECKKYGIEPLVTLCHFDVPMHLVIEYGSWRNRKMVEFFARYARTCFEAFDGLVKYWLTF
NEINILLHSPFSGAGLVFEEGENQEQVKYQAAHHELVASALATKIAHEINPENQVGCMLA
GGNFYPQTCKPADVWAALQKDRENLFFIDVQARGEYPSYTRRVFAEKGVNVVTEPGDDEI
LKNTVDFVSFSYYASRCASADMNDNNSSAANIVKSLKNPYIEASEWGWGIDPLGLRITMN
MMYDRYQKPLFLVENGLGAKDEINAQGEINDDYRISYLREHIRAMGEAITDGVPLIGYTS
WGCIDLVSASTGEMSKRYGFVYVDRDDAGNGTLERKRKKSFYWYKKVIASHGVDLD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatcagcatttcccgaaggctttttatggggcggcgcgatcgccgcaaaccag
gccgaaggcggcagttttgaagggggcaaaggactgacgacggtagatatgatcccgcat
ggcgcgcaccgtctggcagtgaaaaccggtcaggaaaaacgtttctcgctgaaagacgac
gagttttatccggcgcatcaggcgattgatttctaccatcgctacaaagaagacatcgcc
ctgatggcggaaatgggctttaccgtgttccgcacctcgatcgcctggagccgcctgtat
ccgaacggtgatgagctggtgccgaacgctgaaggtatcgcgttttaccgcgacgtattt
gcggaatgcaaaaaatacggcatcgaaccgctggtaacgctgtgccattttgatgtgccg
atgcatctggtcatcgaatacggttcgtggcgtaaccgcaaaatggtggagtttttcgcc
cgctatgcgcggacctgttttgaagcgttcgacgggctggtgaaatactggctgaccttc
aacgaaattaacatcctgctgcacagcccgttctccggtgccggtttagtctttgaagag
ggcgaaaatcaggagcaggtgaaatatcaggcggcgcatcatgagctggtagccagtgct
ttagcgacaaaaattgcccacgaaataaacccggagaatcaggtcggctgtatgctggcg
ggcgggaatttctatccgcaaacctgcaaaccggctgatgtctgggcggcattgcagaaa
gaccgcgaaaacctgttctttatcgatgtgcaggcacgcggcgaatatccgtcgtatacc
cggcgcgtgtttgcggagaagggcgtgaacgtggtcaccgaaccgggcgacgacgagatc
ctgaaaaataccgtcgatttcgtatcctttagctactacgcctcacgctgtgcgtcggca
gacatgaacgacaacaacagcagcgcggcgaacattgttaaatcactgaaaaacccctat
atcgaggccagcgaatggggctggggcattgacccgcttggcctgcgtatcaccatgaac
atgatgtacgaccgctatcagaagccgttattcctggtggaaaacggcctcggcgcgaaa
gatgaaattaacgcgcagggcgaaatcaatgatgattaccgcatcagttatctgcgcgaa
cacatccgcgcgatgggcgaagcgatcaccgacggcgttccgctgatcggctacacctca
tggggctgtatcgatctggtgtccgcctcgaccggcgaaatgagcaagcgctacggcttt
gtttatgtcgaccgcgacgatgccggcaacggcacgctggaaagaaagagaaagaaatcg
ttttactggtacaagaaagtgattgccagtcacggcgtcgatctggactga

DBGET integrated database retrieval system