KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2276Help
Entry
Rahaq2_2276       CDS       T01770                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00340  Histidine metabolism
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
raq01230  Biosynthesis of amino acids
Module
raq_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Rahaq2_2276
Enzymes [BR:raq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Rahaq2_2276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEX52131
UniProt: H2IZE4
Position
complement(2423089..2424429)
Genome map
AA seq 446 aa AA seqDB search
MSASFQAVTFHDLSGSSELPEELFKRTEADLSFFTERVAPIIEAVRTEGDAALRRFARDF
DGVTAPHMSILAEDTEFETAFERLDPQVVESIRFAVENVRAFHEAQKPEDMWMKEIRPGA
FAGDRHVPIDSVACYVPRGKGSFPSVLLMTTIPAVVAGVKRAIVITPPGPDGKVDDATLV
AARLVGITEVYKCGGAQGVAAVAFGTETVPKCLKIVGPGSPWVVAAKRQLSNLIDPGIPA
GPSESLILADDTVDGALAALDLIIESEHGPDSSAYLVTSSRRVAEQAITALPGYWAQLDD
KRAGFSQAVLCGTHGGVVLTEDFAAAIEFVNQYAPEHLEILAEEPMAVMGKIRNAGEILL
GNYTPITLGNFVLGPNAVLPTNGAAKTVGPLSVFDYMKRISVGYVTREGYQPLADKAHAF
ALYEGFPGHALAVSALRTEILNKKGQ
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcatcttttcaagccgtaacttttcatgacctgagtggttcttccgaactgcca
gaggagctgttcaaacgcacggaagctgatttgtcgtttttcactgagcgcgttgcgccg
atcattgaagcggtgcgtaccgaaggcgatgccgccctgcgccgttttgcccgcgatttc
gacggcgttaccgcgccgcatatgagcattctggcggaagatacggaattcgaaacggcg
tttgagcgcctcgatccgcaggtggtggaatcgatccgtttcgccgtcgaaaacgtccgt
gccttccatgaagcgcaaaaaccggaagacatgtggatgaaagaaatccgcccgggtgcg
tttgccggtgaccgccatgtacctatcgattccgtggcctgttacgtgccacgcggtaaa
ggctcattcccgagcgtattactgatgaccaccattccggcggtggtcgcgggggtaaaa
cgcgccattgtcattaccccgcccggcccggacggtaaagtcgatgacgccacgctggtg
gccgcacgtctggtcggcatcaccgaagtgtacaaatgcggcggcgcacagggcgtggcc
gccgtggcgttcggcactgaaaccgtgccgaaatgcctgaaaattgtcggccccggcagc
ccgtgggtagtggctgccaagcgtcaactctcgaatctgatcgaccccggcattcctgcc
ggtccaagcgaaagcctgatcctcgccgatgacaccgtggatggcgcgctggcggcgctg
gatctgatcatcgaatcagaacatggcccggactcttcggcgtatctggtcaccagcagc
cgtcgggtcgctgaacaggctatcaccgcactgcccggttactgggcgcagctcgatgat
aaacgggccggattctcacaggccgtattatgcggaacccacggcggcgtggtgctgaca
gaagatttcgccgccgccattgaatttgttaatcagtacgcgccggagcatctggaaatt
ctggccgaagagccgatggccgtgatgggcaaaatccgcaatgccggtgaaatcctgctc
ggtaattacacgccgatcacgctggggaatttcgttctcggaccgaatgcggttctgccg
accaacggagccgccaaaactgtcggaccattgtctgtgttcgattacatgaaacggatc
tccgtaggttatgtcacccgcgaaggctatcagccgctggccgataaagcgcatgccttt
gcgttatatgaaggattccccggccacgcgctggcggtatcagcattacgcactgagatc
ctcaacaaaaaaggccagtaa

DBGET integrated database retrieval system