KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2381Help
Entry
Rahaq2_2381       CDS       T01770                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rahaq2_2381
Enzymes [BR:raq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Rahaq2_2381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2536015..2536878
Genome map
AA seq 287 aa AA seqDB search
MTQQWWPSPAKLNLFLYITGQRPNGYHDLQTLFQFVDYGDSLSFNVRDDGDIVLTTPVEG
VADDENLVVRAARLLQQHTGTSQGADIALQKRIPMGGGLGGGSSNAATVLVALNALWNCG
LSDTQLAQLGITLGADVPVFVMGHAAFAEGIGEILLPVEPAEKWYLIAHPGVSIPTPVIF
GDPELTRNTPKRTVNVLLDTPYANDCEPIARKRFYEVEQLLSWLLEYAPSRLTGTGACVF
AEFDTESDACQILDITPSWSRSFVAQGVNISPLHRFRDVWLRTAGKA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaatggtggccttctccggctaaactcaatttgttcctttatatcaccggc
cagcgcccgaatggctaccatgatctgcagacactatttcagtttgttgattacggtgac
agcctgagttttaacgtccgggacgacggcgatatcgtgctgactacgcccgttgaaggc
gtggcggatgacgagaatctggtggtacgcgccgcccgtcttctgcaacagcatacgggc
acgtctcagggcgcagacattgccttgcaaaaacgtattccgatgggtggcggtcttggc
ggcggttcatccaacgccgccaccgtgctggtggcactgaatgcgctatggaattgcggc
ctttcggatacccaactggcgcaactgggcataacgctgggcgcggatgtaccggtcttt
gtgatgggccatgctgcctttgctgaaggcattggcgagatcctgctgccggtcgaaccg
gcggaaaaatggtatctgatcgcacatccgggcgtcagcattccaacgccggtgattttt
ggcgatccggaactgaccagaaatacaccaaaacgcactgttaatgtgctattagacacg
ccttacgcaaatgattgcgaaccgattgcgagaaaacgtttttacgaggttgaacagcta
ctttcttggctgttagaatacgcgccgtcgcgactcaccggaacgggtgcctgtgtgttt
gcagaattcgacaccgaatctgacgcctgtcagattttagacataacaccctcgtggagt
cggagttttgtcgcacaaggtgttaatatctcgccgttgcaccgttttcgtgatgtctgg
ttgagaactgcgggcaaagcgtag

DBGET integrated database retrieval system