KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2422Help
Entry
Rahaq2_2422       CDS       T01770                                 

Definition
D-cysteine desulfhydrase family pyridoxal phosphate-dependent protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2590004..2591005
Genome map
AA seq 333 aa AA seqDB search
MMKQADDFERVSLGFFPTPLERLTTLGDSLGITLDIKRDDYTGFGGGGNKVRKLEYLMAD
ACRKQVNVVITTGGHQSNHARMVAAAARKFGMKPVLVLRGHQPETYQGNLLLDKLFGAEL
EFLDPDGYFTQIEGAMNAHADAAQARGEKALIIPLGGATPLGALGYVRAIEEMDAQLKAR
HQLPPEVIVAPTGSGGTLAGLYVGARKYWPDTKIVGISVSAKAQWFQARISAMAQDCADL
LEWPQNWTPEDIWIEDDFVGTAYGVPSDGGIDAIYRVAQAEGLLLDPVYTGKAMHGLISL
VEQGKISAGSRVIFVHCGGSPALYPFAQTLLEH
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacaagcagatgattttgaacgtgtttcactgggattcttccccacgccgctc
gaacgcctgaccacacttggcgattcactgggcatcacgctggatatcaaacgtgatgat
tacaccggttttggcggaggcggaaacaaagtccgcaagctggaatatctgatggccgac
gcctgccgcaaacaggtcaatgtggtgattaccaccggcggacatcagtcaaaccatgcg
cggatggtggcggcggcggcgcgtaagttcggcatgaaaccggtgctggtgctgcgcggc
catcagccggaaacctatcagggcaatcttctgctcgataagctgttcggcgcggaactg
gagtttctcgaccccgacggctatttcacccagattgaaggggcgatgaacgcccatgca
gacgccgcacaggcgcgcggtgaaaaggcgctgattatcccgctcggcggtgccaccccg
ctcggtgcgctgggttatgtgcgcgccatcgaagaaatggacgcccagcttaaagcacgt
catcagttgccgccggaggtgattgtcgccccgaccggttccggcggcacgctggccggg
ctgtacgtgggtgcgcgtaaatactggccggacaccaaaatcgttggcatcagcgtcagt
gccaaagcgcaatggttccaggcacgtatttccgccatggcgcaggattgcgccgacttg
ctggaatggccgcaaaactggacgccggaagatatctggattgaagacgacttcgtcggc
accgcgtatggcgtgccgtctgacggcggcattgacgccatctaccgtgtcgcacaggcc
gaaggtttgctgctggatccggtctacaccggcaaagccatgcacgggctgatcagtctg
gtggagcaaggaaaaatcagtgccggttcccgggtgattttcgtccactgcggcggctca
ccggcgctgtatccttttgcgcagactttgctggagcactga

DBGET integrated database retrieval system