KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2422Help
Entry
Rahaq2_2422       CDS       T01770                                 

Definition
D-cysteine desulfhydrase family pyridoxal phosphate-dependent protein
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rahaq2_2422
Enzymes [BR:raq01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Rahaq2_2422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2590004..2591005
Genome map
AA seq 333 aa AA seqDB search
MMKQADDFERVSLGFFPTPLERLTTLGDSLGITLDIKRDDYTGFGGGGNKVRKLEYLMAD
ACRKQVNVVITTGGHQSNHARMVAAAARKFGMKPVLVLRGHQPETYQGNLLLDKLFGAEL
EFLDPDGYFTQIEGAMNAHADAAQARGEKALIIPLGGATPLGALGYVRAIEEMDAQLKAR
HQLPPEVIVAPTGSGGTLAGLYVGARKYWPDTKIVGISVSAKAQWFQARISAMAQDCADL
LEWPQNWTPEDIWIEDDFVGTAYGVPSDGGIDAIYRVAQAEGLLLDPVYTGKAMHGLISL
VEQGKISAGSRVIFVHCGGSPALYPFAQTLLEH
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacaagcagatgattttgaacgtgtttcactgggattcttccccacgccgctc
gaacgcctgaccacacttggcgattcactgggcatcacgctggatatcaaacgtgatgat
tacaccggttttggcggaggcggaaacaaagtccgcaagctggaatatctgatggccgac
gcctgccgcaaacaggtcaatgtggtgattaccaccggcggacatcagtcaaaccatgcg
cggatggtggcggcggcggcgcgtaagttcggcatgaaaccggtgctggtgctgcgcggc
catcagccggaaacctatcagggcaatcttctgctcgataagctgttcggcgcggaactg
gagtttctcgaccccgacggctatttcacccagattgaaggggcgatgaacgcccatgca
gacgccgcacaggcgcgcggtgaaaaggcgctgattatcccgctcggcggtgccaccccg
ctcggtgcgctgggttatgtgcgcgccatcgaagaaatggacgcccagcttaaagcacgt
catcagttgccgccggaggtgattgtcgccccgaccggttccggcggcacgctggccggg
ctgtacgtgggtgcgcgtaaatactggccggacaccaaaatcgttggcatcagcgtcagt
gccaaagcgcaatggttccaggcacgtatttccgccatggcgcaggattgcgccgacttg
ctggaatggccgcaaaactggacgccggaagatatctggattgaagacgacttcgtcggc
accgcgtatggcgtgccgtctgacggcggcattgacgccatctaccgtgtcgcacaggcc
gaaggtttgctgctggatccggtctacaccggcaaagccatgcacgggctgatcagtctg
gtggagcaaggaaaaatcagtgccggttcccgggtgattttcgtccactgcggcggctca
ccggcgctgtatccttttgcgcagactttgctggagcactga

DBGET integrated database retrieval system