KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2486Help
Entry
Rahaq2_2486       CDS       T01770                                 

Definition
(GenBank) acetylornithine deacetylase/succinyldiaminopimelate desuccinylase-like deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00300  Lysine biosynthesis
raq01100  Metabolic pathways
raq01120  Microbial metabolism in diverse environments
raq01230  Biosynthesis of amino acids
Module
raq_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rahaq2_2486
Enzymes [BR:raq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Rahaq2_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEX52338
UniProt: H2IP91
Position
complement(2664430..2665746)
Genome map
AA seq 438 aa AA seqDB search
MSCEGSLQIALDSIRQDETAILQDLSQMLAVDTCFPPGTGYPAFASLMESLLEPVGFVCE
RVSVPENLWQTPDGSAQGERVNVIATLPGSAAEACNLYFHVDTVPAGDGWNYPPLTLTQA
DGKLIGRGAADMKGTIVAALAAIRAAQRHGLALKFNPVLLLCTDEEGGLYPGVRYLAEQK
LFSGHMLSFNGGAVPRIWGGCFGSIDLKICITGRSAHSGDPVGGINAIEESLPLMNALHT
LKRDVEQRASAMPAPPHFEGRPLTSRLTLAAAQGGGKGSTLPARFELLVNRRYSPEEAFE
TVFKELTDCIGQAMKGSAALAVEYHLIGHLAPVSDPTGPHWPRWLAALSQGFGFHANDFA
VWGSSTSSDMGWVQQAGIQEILLGGLARPENRIHASDEYTTMQDVVALSQSILAYLASDF
TPTENSPTQGFSNSAERV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgtgaaggaagtttgcaaattgcgctggactccatccggcaggacgaaaccgcc
attttacaggatctcagccagatgctggcagtggacacctgcttcccaccgggcaccggt
tatccggcatttgccagtctgatggaatctctgctggagccggttggttttgtctgtgag
cgcgtcagcgtaccggaaaatttgtggcaaacgccggacggcagtgcgcagggcgaacgg
gtgaatgtgattgctaccttgccgggcagcgccgccgaagcctgtaatctctattttcac
gtcgatactgttccggcgggcgatggctggaattacccgccactgacgctgacgcaggct
gatggcaaactgatcggtcgcggcgcggcagacatgaaaggcacgattgtggcggcgctc
gcggcaattcgtgctgcgcaacgtcacgggctggcgctgaaattcaatccggttctgctg
ttgtgtaccgatgaagaaggcggtctgtaccccggggtgcgctatctggcggagcaaaaa
ttattctccggccacatgctcagctttaacggcggggcggtaccgcgtatctggggcggc
tgtttcggcagcatcgacctcaaaatttgtatcaccggccgatcggcgcattccggcgat
ccggtcgggggcatcaatgccattgaagaaagcctgccgctgatgaatgcgctgcatacg
ctcaaacgtgacgttgaacagcgcgcttccgccatgcctgccccccctcattttgaagga
cgtccgctcacatctcgtctcacgctggctgccgcgcaagggggaggcaaaggttcaacc
ctgcccgcacgctttgaactgctggttaaccgccgctattccccggaagaagcgttcgaa
accgtctttaaagaactcacggattgtatcgggcaggcgatgaaaggttctgcggcgctg
gcggtggaatatcacctgatcggccatctggctccggttagcgatccgaccggtccgcac
tggccgcgctggcttgcggcgctaagtcagggttttggcttccacgcaaacgatttcgct
gtctggggttcgtccaccagttccgacatgggctgggttcagcaggcaggcattcaggaa
attttactcggcgggctcgcccggccggaaaaccgtatccatgcatcggacgaatacaca
acgatgcaggacgtcgtcgcgttatcgcagtcaattcttgcttatttagcttctgatttt
actccgacagaaaattcgccaacccagggcttttcgaattcagcagagagggtttaa

DBGET integrated database retrieval system