KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2592Help
Entry
Rahaq2_2592       CDS       T01770                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:raq00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:raq00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2775319..2776638
Genome map
AA seq 439 aa AA seqDB search
MHAYFDKLDAVRYEGANSTNPLAFRHYNPEEVILGKTMAEHLRFAACYWHTFCWNGNDMF
GVGAFDRPWQQPGDALALAKSKADVAFEFFQKLNVPYYCFHDVDVSPEGASLKEYVNNFA
VMTDVLAQKQEDSGVKLLWGTANCFTNPRYGAGAATNPNPEIYTWAATQVVHAMNATKQL
GGENYVLWGGREGYETLLNTDLRQEREQLGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDVASVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIANAIALGIFGSVDANRG
DPQCGWDTDQFPNSVEENALVMYEIIKAGGFTTGGLNFDSKVRRQSTDKYDLFYGHIGGM
DTMALALKVAARMIESRELDKHVAQRYAGWNTELGQQILQGKMSLESLSNYAQQNALAPQ
HQSGQQERLENLVNRYLFG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcatatttcgacaagctcgacgcagttcgctacgaaggtgctaacagcactaac
ccgctggcattccgtcattacaaccctgaagaagtgatcctcggcaaaacgatggctgag
catctgcgtttcgcggcttgttactggcacaccttctgctggaatggtaatgacatgttc
ggtgtgggcgcgtttgaccgtccgtggcaacaacccggcgacgcgctggcgctggccaaa
agtaaagcggatgtcgctttcgaattcttccagaaactgaatgtgccttattattgcttc
catgatgtggatgtctcgccggaaggcgcatcgctgaaagaatatgtgaacaattttgcc
gtcatgactgacgtgctggcacaaaaacaggaagacagcggcgtaaaattgttgtggggt
acagctaactgctttaccaatccacgttacggcgcaggtgcggcgaccaatcctaatcca
gaaatttatacctgggccgcaacacaggttgtgcatgccatgaatgccaccaaacagctg
ggcggcgaaaactacgtgctgtggggtggccgtgaaggctacgaaaccctgctcaatact
gaccttcgtcaggaacgcgaacaattgggtcgcttcatgcaaatggtcgttgagcacaaa
cataaaatcggtttccagggcaccctgctgatcgaacccaaaccgcaggaaccgaccaaa
catcagtacgattatgatgtcgcttccgtctatggcttcctgaaacagtttggtctggaa
aaagagatcaaagtgaatattgaggccaatcacgccaccctggccggtcactcattccac
catgaaattgctaacgcaattgctctcggtatcttcggctctgtggatgccaaccgtggc
gacccgcaatgtggctgggataccgatcagttcccgaacagtgtggaagaaaatgcgctg
gtgatgtatgaaatcatcaaagcgggcgggttcaccaccggcggcctgaattttgactct
aaagtgcgccgtcagagcaccgacaaatacgatctgttctacggtcatatcggcggaatg
gacaccatggcgctggcgctgaaagtggcagcccgtatgattgaaagccgtgagctggat
aaacacgttgctcaacgttatgcaggctggaataccgagctgggtcagcaaatcctgcaa
ggtaaaatgtcgctggaatccctgagcaactatgcgcaacaaaatgcgctggcgcctcag
caccagagcggccagcaggagcgtctggagaatctggttaaccgttatctgtttggttaa

DBGET integrated database retrieval system