KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2766Help
Entry
Rahaq2_2766       CDS       T01770                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:raq00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2979408..2980382)
Genome map
AA seq 324 aa AA seqDB search
MSNQFPSSRLRRLRQSESLRTLFQETEFSVNDLVLPIFVEEETSEYVPIEAMPGVLRIPE
SRLAFEIERYARAGIRSVMTFGISHHMDATGSDTWNENGLVARMARICKDTVPEMIVMSD
TCFCEYTSHGHCGVLHDHGVDNDATLINLGKQAVVAAAAGADFIAPSAAQDGQVQAIRSA
LDEAGFIDTAIMAYSTKFASSLYGPFREAGGSVLKGNRKQYQMNPMNRREAVRESLLDEQ
EGADALMVKPAGAYLDVIRDIREASRLPLAAYQVSGEYAMIKFAAQAGAIDERAVVRESL
GAIKRAGADIILTYFAMDIAENGL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcagttcccgagctcacgccttcgccgcctgagacagtccgaatccctgcgc
actctttttcaggaaactgaatttagcgtcaacgatctggtactgccgattttcgtagaa
gaggagacctctgaatacgtacccatcgaagccatgcccggtgtgctgcgcatccctgaa
tcccgcctggcgttcgagatcgaacgttacgcccgcgccggtatccgctcggtcatgacg
tttggtatttcgcatcacatggatgccaccggcagcgatacctggaatgaaaacggtctg
gtcgcgcgtatggcgcgtatctgcaaagacaccgtgcctgaaatgatcgtcatgtccgac
acctgtttctgcgaatacacctcacatggccattgtggagtgttgcacgatcacggggtg
gataacgacgcgacgctgatcaacctcggcaaacaggccgtcgtggcggcggctgcgggc
gcagattttattgcaccttctgcggcgcaggacggtcaggtgcaggcgatccgcagtgca
ctggatgaagccggtttcattgataccgcgatcatggcgtattccactaagttcgcgtcc
tccctgtacggccctttccgtgaagcgggcggcagtgtactgaaaggcaaccgcaagcaa
tatcagatgaacccgatgaaccgccgcgaagctgtgcgtgaatcattactggatgaacag
gaaggcgctgatgcgctgatggttaaaccggcgggggcgtatctggatgtgatccgcgat
atccgcgaagcctcccgcctgccactggcggcctatcaggtcagcggtgaatacgcgatg
atcaaatttgccgcacaagccggtgctattgatgagcgtgccgtggtgcgtgaaagtctc
ggcgcgattaaacgtgcaggcgcagacattattctgacgtactttgcgatggatatcgct
gaaaacgggctgtag

DBGET integrated database retrieval system