KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2894Help
Entry
Rahaq2_2894       CDS       T01770                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Rahaq2_2894
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq2_2894
  Lipid metabolism
   00071 Fatty acid degradation
    Rahaq2_2894
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rahaq2_2894
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rahaq2_2894
   00626 Naphthalene degradation
    Rahaq2_2894
Enzymes [BR:raq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rahaq2_2894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3120577..3121590)
Genome map
AA seq 337 aa AA seqDB search
MKAAVVNKDHSVGVVEKTLRDLEHGEALLEMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGIVKKIGPGVTALKVGDRASVAWFYKGCGHCEYCTTGNETLCRQVINAGYTIDGGMAEE
CIVSADYAVKVPDGLESAAASSVTCAGVTTYKAVKVSGIQPGKWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDQQLEFAADMGADLTINMLKDDAAKIIQEKVGGAHAAVVTATAKS
AFNSAVDAMRAGGRIVAVGLPPESMSLNIPRLVLDGIQVVGSLVGTREDLAEAFQFAAEG
KVVPKVTKRPLGDINAIFQEMEQGKIKGRMVIDFTHK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttgttaataaagaccactctgtgggcgtcgttgagaagactctgcgt
gacctggaacatggtgaggcacttttagagatggagtgctgtggtgtatgtcatacggat
ttgcatgtcaaaaacggtgattttggtgataagaccggcgtaatcctcgggcatgaaggg
atcggtattgtaaaaaaaatcggaccgggagtcaccgcgttgaaagttggcgatcgtgcc
agcgtcgcgtggttctataaaggctgcgggcattgcgaatattgtacaacgggtaatgaa
acattatgtcgtcaggtgattaatgcaggttataccattgatggtggcatggctgaagag
tgcattgtctcggccgattatgcggtgaaagtcccggatggtctggagtctgcggcagcg
agtagcgtgacctgtgcaggcgtgaccacgtataaagctgtaaaagtatcgggtattcag
ccgggtaaatggattgctatttatggtctgggcggtctaggtaatctggctttgcaatat
gctaaaaatgtattcaacgccaaggtgattgctattgatgttaatgatcagcaactggag
tttgccgccgatatgggcgctgatctgaccattaatatgctaaaagacgatgcagcaaaa
attattcaggagaaagtcggtggcgcgcatgctgcggtggtaacagccacggcgaaatcc
gcttttaactcagcagtagatgcgatgcgtgccggtggtcgtattgtcgcggtgggttta
ccgccggaatccatgagcctgaacattccccgtctggtgcttgatggcattcaggttgtc
ggttcactggtgggtacccgtgaagatctggctgaagctttccagtttgccgctgaaggt
aaagtggtgccgaaagtcaccaaacgtcctctgggcgatatcaatgcgatcttccaggaa
atggaacaaggcaaaattaaaggcagaatggtgatcgattttacgcataagtaa

DBGET integrated database retrieval system