KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2964Help
Entry
Rahaq2_2964       CDS       T01770                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rahaq2_2964
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Rahaq2_2964
Enzymes [BR:raq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Rahaq2_2964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3190564..3191592)
Genome map
AA seq 342 aa AA seqDB search
MLDVAGYALDAEEREILQHPLVGGLILFTRNYHDVDQLHELIRQIRAASHDRLVLAVDQE
GGRVQRFREGFTRLPAAQSFAALNEPHEAARLAQESGWLMASEMIAMDIDISFAPVLDIG
HISAAIGERSFHAEPRKALEIAEQYILGMHSAGMKTTGKHFPGHGAVSADSHKETPRDDR
PLEIIREHDMAIFRQLNERKLLDAVMPAHVIYTQADPRPASGSPYWLQEILRKELNFNGV
IFSDDISMEGAAIMGTYPERAQASLDAGCDMILACNNRQGAVSVLDNLSPVNAERVAQLY
HRGRYTGKQARQDLQNSSRWQEANRDLTTLDARWQEHKQAAL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgtcgctggctatgcgctggatgccgaagaacgtgaaattttgcagcatccg
ctggtgggcgggctgattttattcacccgaaattatcatgatgtcgatcagttgcatgaa
ctgatccgtcagatccgcgctgcgtcgcacgacaggctggtactggccgtggatcaggaa
ggcggacgtgtgcagcgttttcgcgaaggtttcacccgtttgcctgcggcacaatctttt
gctgccctcaatgagccacatgaagccgcacgactcgcgcaggaaagcggctggctgatg
gcgtcagaaatgattgcgatggatatcgacatcagctttgcgcctgtgctggatatcggg
catatcagcgcagctatcggcgaacgttcattccatgcagaaccccggaaagcactggag
atagctgaacagtatattctcggtatgcattctgctggcatgaaaaccaccggtaagcat
tttccggggcacggtgccgtcagtgcggattcccataaagaaacaccgcgtgacgatcgg
ccactggagattatccgcgagcacgacatggctatcttccgtcagcttaacgaacgtaaa
ttgctggatgccgtgatgccagcgcacgtgatatatacccaggccgatccgcgtccggcc
agtggttcgccatactggttgcaggaaattttacgcaaggagctgaatttcaacggcgtg
atcttctccgatgatatttccatggaaggcgcggcaatcatggggacgtatcccgagcgc
gcgcaggcctctctggatgcgggctgcgacatgatcctggcctgtaataaccggcagggg
gcggtgagcgtgctggataacctgtccccggtcaacgctgagcgtgttgcacagttgtat
catcgcggacggtacactggaaaacaggcccgtcaggacctgcaaaattcgagtcgctgg
caagaggcaaaccgtgatctgaccacactcgacgcccgctggcaggaacacaaacaggct
gccctgtaa

DBGET integrated database retrieval system