KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3094Help
Entry
Rahaq2_3094       CDS       T01770                                 

Definition
phosphonate ABC transporter, permease protein PhnE
Orthology
K02042  
phosphonate transport system permease protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
ABC transporters
Module
Phosphonate transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:raq02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3313966..3314829)
Genome map
AA seq 287 aa AA seqDB search
MNKDFNRYYQQIRGKQKREALIWSGLMLLLYLWSGNVSELNLKTIIVSAPSFFDYIGQTV
PVLHWSLLFADGHTEGSLAYWGYRLNIQLPLIWETIQLALSSTILSTALAVVLAFLAASN
TDSPKWVKFSIRTFVAFLRTMPELAWAVMCVMAFGVGAIPGFIALTLHTVGSLTKLFYES
IETASDKPVRGLRACGAGRLQRMRFAMWPQVKPIFLSYSFMRLEINFRQSTILGLVGAGG
IGQELMTSIKLDRYDQVSMTLLLIILVVSAMDFLSGKLRKRVVEGTF
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaagacttcaatcgttattaccagcagatacgcggtaaacaaaagcgggaagcg
ctgatctggtcagggctgatgctgttgttatatctgtggtcaggcaatgtttccgaactt
aatttaaaaacgattattgtctctgcccccagcttctttgattatattggtcagacggtg
ccggtattacactggtcattattatttgctgacggtcataccgaaggttcactggcgtac
tggggatatcgtctcaatattcagctgccgctgatttgggaaactattcagctggcgttg
tcctcgacgatattgtcgacagcgctggcggtcgtgctggcttttctcgccgccagtaat
acggattcgcctaaatgggtgaaattcagcatccgtacttttgtcgctttcctgcgcacc
atgccggaactggcctgggcagtgatgtgtgtgatggcatttggcgtcggtgccattccg
ggttttatcgccctgacgttacacactgtcggcagcctgaccaaattgttctacgaatct
attgaaaccgcatcagacaaaccggtgcgtggcctcagggcctgcggcgcggggcgtttg
cagcgcatgcgtttcgccatgtggccgcaggtgaaaccgatcttcttatcctacagcttt
atgcgcctcgaaattaacttccgccagtcgactatcctcgggctggtcggggccggtggt
atcggacaggagctgatgacctcaatcaaactggaccgctatgatcaggtcagcatgacg
ttactgctgattattctggtggtgtcggctatggattttctttccggtaaattacgtaaa
cgcgttgtggagggcactttctga

DBGET integrated database retrieval system