KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3152Help
Entry
Rahaq2_3152       CDS       T01770                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00010  Glycolysis / Gluconeogenesis
raq00052  Galactose metabolism
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
raq01120  Microbial metabolism in diverse environments
raq01130  Biosynthesis of antibiotics
Module
raq_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq2_3152
   00052 Galactose metabolism
    Rahaq2_3152
Enzymes [BR:raq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Rahaq2_3152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEX52972
UniProt: H2IWH7
Position
3370139..3371185
Genome map
AA seq 348 aa AA seqDB search
MLKPENTQLAPDGQPFEQVTLQNAAGATATFMDWGATWLSFTLPLADGTTRELLLGCQSP
LEYMNQSAYLGATVGRYANRIARAQFNIDGKPHLVVANQGVHQLHGGPEGFHARRWTILE
QTAQKLTFQLFSADGDQGYPGNMTAKVHYHLTDDNRLEIRYEATVDKLCPVNLTNHAYFN
LDGEGTDVRQHKLQLFADRFLPVDSDGIPCADPTPVENTGMNFNAAKTLAKDFLADRDQQ
RVKGYDHAYLLNRTCNSGSNPAAHLWSADGKVKMTMFTSAPAVQLYSGNFLGGTPNRSGG
AYASYSGVALESEFLPDSPNHVTWPQPSCWIKPGQTYKSSTTYQFFAL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaacctgaaaacacacagctggcgcccgatggccagccgtttgaacaggtgacg
ctacagaatgcggcgggtgccaccgccacattcatggactggggcgcgacctggttatcc
ttcaccctgccgctggcagatggcacgacgcgtgaactgctgctcggctgccagtcaccg
ctggaatacatgaaccagagcgcctatctgggtgccaccgtcggacgttacgccaaccgt
atcgcccgcgcgcagtttaacatcgacggcaaaccgcatctggtggtcgccaatcagggc
gtgcatcagcttcatggcgggccggaaggcttccatgcgcgtcgctggacgattctggag
cagaccgcacagaagctgacgttccagctattttctgccgacggcgatcagggttatccg
ggcaatatgaccgcgaaagtgcattaccatctgactgatgataaccgtctggaaatccgt
tacgaagccaccgtggataagctgtgcccggtcaatctgaccaatcatgcctatttcaat
ctcgacggcgaaggcaccgatgtgcgccagcacaagctgcaactgtttgcggaccgtttc
ctgccggtcgacagcgatggcattccttgtgcagatccgaccccggttgaaaataccggt
atgaatttcaacgcggccaaaacgctggcgaaagatttcctcgctgaccgcgaccagcaa
cgcgtgaaaggctatgaccatgcctatctgctcaaccgcacctgcaacagcggcagcaat
ccggcggcgcatttgtggtctgccgacggcaaagtcaaaatgacgatgtttacgtcagcg
cccgccgtgcagctctacagcggtaatttcctgggcggaacaccgaaccgcagcggcggc
gcatacgccagctacagtggtgtggcgctggaaagcgaattcctgccggacagcccgaac
cacgtcacctggccgcagccgagctgctggatcaaacccggtcagacctacaaatcctcg
acaacgtatcagttcttcgcgttgtaa

DBGET integrated database retrieval system