KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3154Help
Entry
Rahaq2_3154       CDS       T01770                                 

Definition
(RefSeq) phosphoglycerate mutase, BPG-dependent, family 1
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rahaq2_3154
   01230 Biosynthesis of amino acids
    Rahaq2_3154
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq2_3154
  Energy metabolism
   00680 Methane metabolism
    Rahaq2_3154
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rahaq2_3154
Enzymes [BR:raq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rahaq2_3154
Exosome [BR:raq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rahaq2_3154
  Exosomal proteins of melanoma cells
   Rahaq2_3154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3371878..3372630
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNKENRFTGWHDVELSEKGRTEAKAAGQLLKDEGFQFDFAYTSVL
KRAIHTLWSVLDELNQPWLPVEKSWKLNERHYGALQGLDKAETAQKYGDEQVKQWRRGFA
VTPPELDRADERFPGHDPRYAKLTEAELPTTESLALTIERVIPYWTDVIKPRIASGERVI
IAAHGNSLRALVKYLDNLSEDEILELNIPTGVPLVYEFDENYKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaccaagctggtgctggtaagacacggtgagagtgagtggaacaaagaaaac
cgctttaccggttggcatgatgttgaactgtccgagaagggccgcactgaagcaaaagct
gcgggtcagctgttgaaagacgaaggcttccaattcgattttgcatacacctctgtgctg
aaacgtgccatccataccctgtggagcgttttggacgaactgaatcagccatggctgccg
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcaaggtctggataaa
gcagaaactgcacagaaatacggtgacgagcaagttaaacaatggcgtcgtggttttgct
gtaacacctccggagctggatcgcgctgacgaacgtttccctggccacgacccgcgttac
gctaaactgaccgaggcagaactgccaaccacagaaagcctggcgctgaccatcgaacgt
gttattccttactggactgacgtgatcaaaccacgcatcgccagcggcgagcgcgtcatc
atcgcggcacacggtaactccctgcgcgcactggttaaatatctcgacaacctgagcgaa
gatgaaattctggaactgaacatccctaccggtgttccgctggtttacgaatttgacgaa
aactacaaaccaatcaaacgttactatctgggtaacgccgacgaaatcgcagcgaaagca
gcggccgtggcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system