KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3154Help
Entry
Rahaq2_3154       CDS       T01770                                 

Definition
phosphoglycerate mutase, BPG-dependent, family 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rahaq2_3154
   01230 Biosynthesis of amino acids
    Rahaq2_3154
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq2_3154
  Energy metabolism
   00680 Methane metabolism
    Rahaq2_3154
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rahaq2_3154
Enzymes [BR:raq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rahaq2_3154
Exosome [BR:raq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rahaq2_3154
  Exosomal proteins of melanoma cells
   Rahaq2_3154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3371878..3372630
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNKENRFTGWHDVELSEKGRTEAKAAGQLLKDEGFQFDFAYTSVL
KRAIHTLWSVLDELNQPWLPVEKSWKLNERHYGALQGLDKAETAQKYGDEQVKQWRRGFA
VTPPELDRADERFPGHDPRYAKLTEAELPTTESLALTIERVIPYWTDVIKPRIASGERVI
IAAHGNSLRALVKYLDNLSEDEILELNIPTGVPLVYEFDENYKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaccaagctggtgctggtaagacacggtgagagtgagtggaacaaagaaaac
cgctttaccggttggcatgatgttgaactgtccgagaagggccgcactgaagcaaaagct
gcgggtcagctgttgaaagacgaaggcttccaattcgattttgcatacacctctgtgctg
aaacgtgccatccataccctgtggagcgttttggacgaactgaatcagccatggctgccg
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcaaggtctggataaa
gcagaaactgcacagaaatacggtgacgagcaagttaaacaatggcgtcgtggttttgct
gtaacacctccggagctggatcgcgctgacgaacgtttccctggccacgacccgcgttac
gctaaactgaccgaggcagaactgccaaccacagaaagcctggcgctgaccatcgaacgt
gttattccttactggactgacgtgatcaaaccacgcatcgccagcggcgagcgcgtcatc
atcgcggcacacggtaactccctgcgcgcactggttaaatatctcgacaacctgagcgaa
gatgaaattctggaactgaacatccctaccggtgttccgctggtttacgaatttgacgaa
aactacaaaccaatcaaacgttactatctgggtaacgccgacgaaatcgcagcgaaagca
gcggccgtggcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system