KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3154Help
Entry
Rahaq2_3154       CDS       T01770                                 

Definition
(GenBank) phosphoglycerate mutase, BPG-dependent, family 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00010  Glycolysis / Gluconeogenesis
raq00260  Glycine, serine and threonine metabolism
raq00680  Methane metabolism
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
raq01120  Microbial metabolism in diverse environments
raq01130  Biosynthesis of antibiotics
raq01200  Carbon metabolism
raq01230  Biosynthesis of amino acids
Module
raq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
raq_M00002  Glycolysis, core module involving three-carbon compounds
raq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq2_3154
  Energy metabolism
   00680 Methane metabolism
    Rahaq2_3154
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rahaq2_3154
Enzymes [BR:raq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rahaq2_3154
Membrane trafficking [BR:raq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Rahaq2_3154
Exosome [BR:raq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rahaq2_3154
  Exosomal proteins of melanoma cells
   Rahaq2_3154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEX52974
UniProt: H2IWH9
Position
3371878..3372630
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNKENRFTGWHDVELSEKGRTEAKAAGQLLKDEGFQFDFAYTSVL
KRAIHTLWSVLDELNQPWLPVEKSWKLNERHYGALQGLDKAETAQKYGDEQVKQWRRGFA
VTPPELDRADERFPGHDPRYAKLTEAELPTTESLALTIERVIPYWTDVIKPRIASGERVI
IAAHGNSLRALVKYLDNLSEDEILELNIPTGVPLVYEFDENYKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaccaagctggtgctggtaagacacggtgagagtgagtggaacaaagaaaac
cgctttaccggttggcatgatgttgaactgtccgagaagggccgcactgaagcaaaagct
gcgggtcagctgttgaaagacgaaggcttccaattcgattttgcatacacctctgtgctg
aaacgtgccatccataccctgtggagcgttttggacgaactgaatcagccatggctgccg
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcaaggtctggataaa
gcagaaactgcacagaaatacggtgacgagcaagttaaacaatggcgtcgtggttttgct
gtaacacctccggagctggatcgcgctgacgaacgtttccctggccacgacccgcgttac
gctaaactgaccgaggcagaactgccaaccacagaaagcctggcgctgaccatcgaacgt
gttattccttactggactgacgtgatcaaaccacgcatcgccagcggcgagcgcgtcatc
atcgcggcacacggtaactccctgcgcgcactggttaaatatctcgacaacctgagcgaa
gatgaaattctggaactgaacatccctaccggtgttccgctggtttacgaatttgacgaa
aactacaaaccaatcaaacgttactatctgggtaacgccgacgaaatcgcagcgaaagca
gcggccgtggcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system