KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3178Help
Entry
Rahaq2_3178       CDS       T01770                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rahaq2_3178
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rahaq2_3178
   00640 Propanoate metabolism
    Rahaq2_3178
   00660 C5-Branched dibasic acid metabolism
    Rahaq2_3178
Enzymes [BR:raq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rahaq2_3178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3389470..3390636)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFLRYGLPAPTGFACSTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAEHWLGKRLVTYQTDASGQPVNQILVEAATDIDQELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLAGPQPYQGRELAFKLGLTGKQVQQFTKI
FMGLANIFLERDLALIEINPLVVTTAGDLICLDGKLGADGNALFRQPELREMRDYSQEDA
RESQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDEKVKAVFVNIFGGIVRCDLIADGIIGAVEEVGVSVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTNAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggcgaaacagctgttcctgcgctacggcctgccagcacca
acgggcttcgcctgttccaccccgcgtgaagcggaagaggctgcatcgaaaatcggtgcc
ggtccgtgggtggtgaaatgtcaggttcatgccggtggccgcggtaaagcgggcggcgtg
aaagtggttaaaagcaaagaagaaatccgtgcttttgctgagcactggctgggcaaacgt
ctggtgacttatcagacagacgccagcggtcagccggttaaccagatcctggttgaagcg
gcaacggatatcgatcaggaactgtacctcggtgcggttgtggatcgcagctcccgtcgc
gtggtgttcatggcctctaccgaaggcggcgtggaaatcgagaaagtggcggaagaaacc
ccgcacctgatccacaaagttgcgcttgatccgctggcaggtccgcagccgtatcagggc
cgcgaactggctttcaaactgggtctgaccggtaagcaggttcagcagttcactaagatc
ttcatgggtctggcgaacatcttccttgagcgcgatctggcgctgatcgaaatcaacccg
ctggtagtgactaccgctggcgacctgatctgtctcgacggcaaactgggtgcggacggc
aacgccttgttccgtcagccagaattgcgtgaaatgcgcgattacagccaggaagatgcc
cgtgagtctcaggcagcgcagtgggaactgaactatgttgccctcgacggtaacattggt
tgcatggtgaacggtgccggtctggcaatgggtaccatggatatcgtgaaactgcacggc
ggtgaaccggctaacttcctcgatgtgggcggtggcgcaaccaaagaacgtgtgaccgaa
gccttcaaaatcatcctgtccgatgaaaaagtcaaagccgtcttcgtcaacatcttcggc
ggtatcgtacgttgcgacctgatcgccgatggtatcatcggtgcggtggaagaagtgggc
gtcagcgtgccggttgtggtgcgtcttgaaggtaataatgccgagctgggtgccaaaaaa
ctggcagacagcggtttgaacatcattgcagcgaccagcctgacgaatgcggctcaacaa
gttgtcgcggcagtggaggggaaataa

DBGET integrated database retrieval system