KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3179Help
Entry
Rahaq2_3179       CDS       T01770                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rahaq2_3179
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rahaq2_3179
  Amino acid metabolism
   00310 Lysine degradation
    Rahaq2_3179
Enzymes [BR:raq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rahaq2_3179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3390737..3391966)
Genome map
AA seq 409 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVERDDVLVEIETDKVVLEVPASEAGILDSI
IEDEGATVISRQILARIRPGNSSGKPSTEKSSDKEATPAARHTAALEEENNDALSPAIRR
LIAEHSLDASAIKGSGVGGRLTREDIEQHLAKAKDAKPAAAPAAAPAATSAAPALGSRSE
KRVPMTRLRKRVAERLLEAKNSTAMLTTFNEINMKPIMDLRKQYGDGFEKRHGVRLGFMS
FYLKAVVEALKRYPEVNASIDGDDVVYHNYFDVSIAVSTPRGLVTPVLRDVDTLGMADIE
KQIKELAIKGRDGKLKVEELTGGNFTVTNGGVFGSLMSTPIINPPQSAILGMHAIKDRPM
AVNGQVVILPMMYLALSYDHRLVDGRESVGFLVTIKEMLEDPARLLLDV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggtccctgaccttcctgaatccgttgcggatgcgacggtt
gccacctggcacaaaaagccgggcgacagtgttgagcgtgacgatgtactggtagaaatt
gaaaccgataaagtggttctggaagtgccggcaagtgaagccggtattctggacagcatt
atcgaagacgaaggtgcgacggtgatttcccgtcagatcctggcgcgtatccgtccgggt
aacagcagcggtaagccaagcactgagaaaagctccgataaagaagcgactcctgcggca
cgccacacagcagcactggaagaagagaataacgacgcactcagcccggcgatccgccgt
ctgattgcagaacattctctcgatgccagcgcgattaaaggcagcggtgtcggcggtcgt
ctgacccgtgaagatatcgaacagcatctggcgaaagccaaagacgctaagccagccgca
gcacctgcggcggctccggctgccaccagcgccgcaccggctctgggttcacgtagcgaa
aaacgtgtaccgatgacccgtctgcgtaaacgcgttgctgagcgtttgcttgaagcgaaa
aacagcacggcgatgctgaccactttcaacgaaatcaacatgaagcccatcatggatctg
cgtaagcagtacggtgatggtttcgaaaaacgtcacggcgtgcgtctgggtttcatgtct
ttctatctgaaagccgtggttgaagcgctgaaacgctacccggaagtcaatgcctctatt
gacggcgatgatgtggtttaccacaactatttcgatgtcagcattgcggtttctacgcca
cgcggtctggtgaccccggttctgcgtgatgtcgatacgctgggcatggcggatatcgag
aagcaaatcaaagagctggcgatcaaaggccgtgacggcaaactgaaagtggaagaactg
accggtggtaactttactgtaaccaacggcggtgtcttcggttccctgatgtccacgccg
atcatcaacccgccacagagcgcgatcctgggcatgcatgccattaaagatcgcccgatg
gcagtcaatggtcaggtggtgattttgccaatgatgtatctggcactgtcatacgatcac
cgtctggttgatggccgcgaatccgtcggcttcctggtgaccattaaagagatgctggaa
gatccggctcgtctgctgctggacgtctag

DBGET integrated database retrieval system