KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3219Help
Entry
Rahaq2_3219       CDS       T01770                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:raq00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3438259..3439923
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLDIKTDSVELRKKALELSRLMRHRGPDWSGVFASDKAILSHERLSIVDVNNGA
QPLYNAAHTHVLAVNGEIYNHQALRAELGDKYEFQTASDCEVILALYQEKGPAFLDELQG
MFAFILYDTEKDAYLIGRDHLGIIPLYMGYDEHGNMYVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIREYYQRDWFDFENVKDNVTDAAALKDALEEAVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAGRRIEDKDQSEAWWPQLHSFAVGLQGSPDLRAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGADEVLGGYLY
FHKAPNAKEFHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPKD
KMCGNGKMEKHILRECFESYLPHSVAWRQKEQFSDGVGYSWIDTLKEVASQQITDQQLET
AHFRFPYNTPTSKEGYLYRTIFEELFPVPSAAECVPGGPSVACSSAKAIEWDEAFKNMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaattttcggtgtgctcgatatcaaaactgactccgtcgagctgcgcaaaaaa
gcgctggaactgtcgcgcctgatgcgtcaccgcggacccgactggtccggtgtgtttgcc
agcgataaagcaattctgtcacatgagcgtctgtccattgtcgacgtgaacaacggcgct
caacctttatataacgcggcacacacgcatgttctggctgttaacggcgaaatatacaac
catcaggctttgcgcgctgagctgggcgacaagtatgaattccagaccgcgtctgactgt
gaagtgattctggcgctgtatcaggaaaaaggcccagccttcctcgatgaactgcaaggc
atgttcgcattcatcctttatgacacagaaaaagacgcttacctgattggccgtgaccat
ttaggcatcatcccgctgtatatgggttatgacgaacacggcaacatgtatgtggcttca
gaaatgaaggcgctggtgcccgtttgccgcaccatcaaagaattcccggcaggcagctat
ttatggagccaggacggtgaaattcgcgaatattatcagcgcgactggtttgacttcgaa
aatgtcaaagacaacgtaaccgacgctgcggcgttgaaagatgcgctggaagaagcggtg
aaaagtcacctgatgtctgacgtaccttacggcgtgctgctgtcaggtggtctggattcc
tccgtgatttctgccatcaccaagaaatttgccggtcgccgtatcgaagataaagaccag
agcgaagcctggtggccgcaactgcactcctttgccgtcggtctgcaaggttccccggac
ctgcgcgctgctcaggaagtcgccaaccatttgggcaccgtgcatcacgaaattcatttc
accgtgcaggaaggtctggatgcgatccgcgacgtgatttatcacatcgaaacttatgac
gtcacgactatccgggcctcaacgccaatgtatctgatgtcgcgtaaaatcaaagcgatg
ggcatcaagatggtgttgtccggcgaaggtgctgacgaagtgctgggcggctatctgtat
ttccataaggcgccgaacgccaaagaattccacgaagaaaccgtgcgtaaattgctggcc
ctgcacatgtatgactgtgcgcgtgctaacaaagccatgtcagcctggggtgttgaagcc
cgcgtaccgttcctggacaaaaaattcctcgacgtcgcaatgcgtatcaacccgaaagac
aagatgtgcggcaacggtaagatggagaaacatatcctgcgtgaatgtttcgagtcttat
ttaccccacagcgttgcatggcgtcagaaagaacagttctctgatggtgtaggttacagc
tggatcgatactttaaaagaagtggcctcacagcagatcaccgatcaacagcttgaaact
gcacatttccgtttcccgtacaacacgccgacatcgaaagaaggttatctgtaccgcacg
atttttgaagaattgttcccggtgccaagtgcggctgaatgtgtacctggcgggccgtca
gtggcctgttcttctgcgaaagcgattgagtgggacgaagcgttcaaaaacatggacgat
ccttccggccgtgctgttggcgtgcatcagtccgcctacaaataa

DBGET integrated database retrieval system