KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3219Help
Entry
Rahaq2_3219       CDS       T01770                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rahaq2_3219
Enzymes [BR:raq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Rahaq2_3219
Peptidases [BR:raq01002]
 Cysteine Peptidases
  Family C44
   Rahaq2_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3438259..3439923
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLDIKTDSVELRKKALELSRLMRHRGPDWSGVFASDKAILSHERLSIVDVNNGA
QPLYNAAHTHVLAVNGEIYNHQALRAELGDKYEFQTASDCEVILALYQEKGPAFLDELQG
MFAFILYDTEKDAYLIGRDHLGIIPLYMGYDEHGNMYVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIREYYQRDWFDFENVKDNVTDAAALKDALEEAVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAGRRIEDKDQSEAWWPQLHSFAVGLQGSPDLRAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGADEVLGGYLY
FHKAPNAKEFHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPKD
KMCGNGKMEKHILRECFESYLPHSVAWRQKEQFSDGVGYSWIDTLKEVASQQITDQQLET
AHFRFPYNTPTSKEGYLYRTIFEELFPVPSAAECVPGGPSVACSSAKAIEWDEAFKNMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaattttcggtgtgctcgatatcaaaactgactccgtcgagctgcgcaaaaaa
gcgctggaactgtcgcgcctgatgcgtcaccgcggacccgactggtccggtgtgtttgcc
agcgataaagcaattctgtcacatgagcgtctgtccattgtcgacgtgaacaacggcgct
caacctttatataacgcggcacacacgcatgttctggctgttaacggcgaaatatacaac
catcaggctttgcgcgctgagctgggcgacaagtatgaattccagaccgcgtctgactgt
gaagtgattctggcgctgtatcaggaaaaaggcccagccttcctcgatgaactgcaaggc
atgttcgcattcatcctttatgacacagaaaaagacgcttacctgattggccgtgaccat
ttaggcatcatcccgctgtatatgggttatgacgaacacggcaacatgtatgtggcttca
gaaatgaaggcgctggtgcccgtttgccgcaccatcaaagaattcccggcaggcagctat
ttatggagccaggacggtgaaattcgcgaatattatcagcgcgactggtttgacttcgaa
aatgtcaaagacaacgtaaccgacgctgcggcgttgaaagatgcgctggaagaagcggtg
aaaagtcacctgatgtctgacgtaccttacggcgtgctgctgtcaggtggtctggattcc
tccgtgatttctgccatcaccaagaaatttgccggtcgccgtatcgaagataaagaccag
agcgaagcctggtggccgcaactgcactcctttgccgtcggtctgcaaggttccccggac
ctgcgcgctgctcaggaagtcgccaaccatttgggcaccgtgcatcacgaaattcatttc
accgtgcaggaaggtctggatgcgatccgcgacgtgatttatcacatcgaaacttatgac
gtcacgactatccgggcctcaacgccaatgtatctgatgtcgcgtaaaatcaaagcgatg
ggcatcaagatggtgttgtccggcgaaggtgctgacgaagtgctgggcggctatctgtat
ttccataaggcgccgaacgccaaagaattccacgaagaaaccgtgcgtaaattgctggcc
ctgcacatgtatgactgtgcgcgtgctaacaaagccatgtcagcctggggtgttgaagcc
cgcgtaccgttcctggacaaaaaattcctcgacgtcgcaatgcgtatcaacccgaaagac
aagatgtgcggcaacggtaagatggagaaacatatcctgcgtgaatgtttcgagtcttat
ttaccccacagcgttgcatggcgtcagaaagaacagttctctgatggtgtaggttacagc
tggatcgatactttaaaagaagtggcctcacagcagatcaccgatcaacagcttgaaact
gcacatttccgtttcccgtacaacacgccgacatcgaaagaaggttatctgtaccgcacg
atttttgaagaattgttcccggtgccaagtgcggctgaatgtgtacctggcgggccgtca
gtggcctgttcttctgcgaaagcgattgagtgggacgaagcgttcaaaaacatggacgat
ccttccggccgtgctgttggcgtgcatcagtccgcctacaaataa

DBGET integrated database retrieval system