KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3291Help
Entry
Rahaq2_3291       CDS       T01770                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rahaq2_3291
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rahaq2_3291
Enzymes [BR:raq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Rahaq2_3291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3503420..3504547
Genome map
AA seq 375 aa AA seqDB search
MSCPVLDLAQQLIRRPSLSPDDAGCQEIMIARLEAIGFHVEPMHFGDTLNFWATRGEGKT
LAFAGHTDVVPTGDHKLWVTGPFEPTLRDGMLYGRGAADMKGSLAAMVVAAERFVAANPN
HQGRLAFLITSDEEASAVNGTVKVVSALMARNERLDYCLVGEPSSTTRVGDIVKNGRRGS
MTANLHVHGVQGHVAYPHLADNPVHRAMPALNELVATVWDNGNEFFPPTSMQIANINAGT
GSNNVIPGELYVQFNFRFSTELTDDIIRQRVAELLDRHNLQYTLNWVVSGQPFLTSRGAL
VDAVVNAVRHYSEITPELQTTGGTSDGRFIALMGAQVVELGPVNATIHKINECVHAADLQ
VLSRMYQRIMEQLIA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtccggttctcgatttagcccaacagttaatccgccgcccttccctcagcccg
gacgatgccggctgtcaggagattatgattgcccgccttgaggccattgggttccacgtt
gagccgatgcattttggcgataccctgaatttctgggcgacacgtggtgaaggcaaaacg
ctggcctttgccgggcataccgacgtcgtccctaccggcgatcacaaactgtgggttacc
ggcccgtttgagccgacgctgcgcgacggcatgttgtatggccgcggtgcggcagacatg
aaaggttcactggcggcgatggtggtggcagcagagcgttttgtcgccgccaacccgaat
catcagggccgtctggcttttctcattacttccgatgaggaagccagcgccgttaacggc
acggtgaaagtggtcagcgcgctgatggcacgcaatgagcgcctcgattactgtctggtt
ggcgagccttccagcaccacgcgcgtcggcgatattgtgaaaaatggccgtcgcggttcc
atgaccgccaacctgcatgtgcatggcgttcaggggcacgtcgcctatccgcatctggcg
gataatccggtacaccgtgccatgccagcgctgaatgaactggtcgccactgtatgggat
aacggcaacgaattcttcccgccgaccagcatgcaaatcgccaatatcaacgcaggcacc
ggcagcaacaacgtcattccgggcgaactgtatgtgcagttcaatttccgtttcagcacc
gaactgaccgatgacatcatcagacagcgcgtcgccgaattactggatcgccataacctg
caatacaccctgaactgggtggtttccggccagccattcctgacatcacgcggtgcgctg
gtggatgcggtggtcaacgccgtgcgtcactacagcgaaatcacgccggaactgcaaacc
accggcggcacctccgacgggcgttttatcgcgctgatgggggcgcaggtggtggaactg
gggccggtcaacgcgactatccacaaaatcaatgaatgcgtccatgccgccgatctgcag
gtgctcagccgcatgtatcagcgcattatggaacagttaatcgcatga

DBGET integrated database retrieval system