KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3369Help
Entry
Rahaq2_3369       CDS       T01770                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rahaq2_3369
Enzymes [BR:raq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rahaq2_3369
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Rahaq2_3369
Lipid biosynthesis proteins [BR:raq01004]
 Fatty acid synthase
  Component type
   Rahaq2_3369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3576547..3577131
Genome map
AA seq 194 aa AA seqDB search
MSVLLSFRAVAADNLLIIGDSLSAVYRLPVAESWPTLLNNAWQKEDSKPTVINASISGDT
AEQGLARLPSLLQQHHPRWVLIELGANDGLRGFPPQALSRTLTQVITLVKQAGAQPLLMQ
IRLPPNYGRRYGDAFYAIYPALAKQENIPLVPFFMEQVAVKPEWMQDDGLHPALAAQSFI
AGWMSEKLTPLLTH
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagtattattgagttttcgcgccgttgctgctgataacttgctgattattggcgac
agtttgagtgcagtttatcgccttccggtcgccgaatcctggccgacattactgaataac
gcatggcaaaaagaagacagtaagcccaccgttatcaacgccagcatcagcggcgatacc
gctgaacaaggactggcacgcctgccgtctttactgcaacaacatcaccctcgctgggtg
ctgattgaactgggcgccaacgacgggctccgcggtttcccgccacaagcgctttcccgg
acgctgacgcaggtgatcacactggtcaaacaggctggtgcccaacccctgctgatgcaa
atccgtctgccgcccaattatggccgccgctacggcgatgcgttctatgccatttatccg
gcgctggcaaagcaggaaaatatcccgctggtgccgttctttatggagcaggtcgccgta
aaacctgaatggatgcaggacgacggtttacatccggccctggcagcccagtcgtttatt
gccggatggatgtcagaaaaactcacgccgctgctgacgcattaa

DBGET integrated database retrieval system