KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3387Help
Entry
Rahaq2_3387       CDS       T01770                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:raq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rahaq2_3387
DNA repair and recombination proteins [BR:raq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Rahaq2_3387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3594879..3595484)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQSLTRAMSEIGHCADC
RTFTEQEICTICANPRRKENGQICVVESPADIHAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLGRLEERLESENIQEVILATNPTVEGEATANYIAEMCGQYGVLASRIAHGVPVGGE
LDMVDGTTLSHSLAGRHPFRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagccctctccttgaatctttaatggaggcgttgcgttgcctgccgggcgtt
ggcccgaagtctgcgcaacgtatggcattccagttgttgcaacgtgatcgcagcggcgga
atgcggctggcacagtctttaacgcgtgccatgtctgaaattggccattgtgccgattgc
cggaccttcaccgagcaggaaatctgtacgatttgcgccaatccacggcgtaaagaaaac
ggccagatttgtgtggtggaaagtccggcggacattcacgcgatagaacaaaccggtcag
ttctctggtcgctattttgtgctgatgggccacctgtcgcccctggatggcatcgggcct
gacgacattggtttaggccgtctggaagagcgtcttgaaagtgaaaatattcaggaagtg
atcctcgcgactaacccgacggtcgaaggtgaagcgaccgccaactacatcgctgaaatg
tgcggccagtacggcgtgctggcgagccgtatcgcgcacggtgtgccggtcggtggcgaa
ctggatatggtcgacggcaccacgctgtcgcattcccttgccggacgtcatcccttccgg
ttctga

DBGET integrated database retrieval system