KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3753Help
Entry
Rahaq2_3753       CDS       T01770                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rahaq2_3753
Enzymes [BR:raq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Rahaq2_3753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3984703..3985182
Genome map
AA seq 159 aa AA seqDB search
MIRVYLALGSNLARPLDQVNCALEALAHLPRTRFVAASPFYRSKPLGPQDQPDYLNAVVA
LDTLLPPEQLLDCTQGIEQNQGRVRKAERWGPRTLDLDMLTYGNQVINTERLTVPHYDMK
NREFMLYPLADLAPELVFPDGETLQSLLARVPLNGLTRW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgcgtttacctggctctgggcagtaatcttgcccgtccgcttgaccaggtaaac
tgcgcactggaggcgctggcacatctgccgcgcacccgatttgtggccgcctccccgttt
taccgcagtaaaccgctggggccacaagatcaacctgattatctgaatgcggtggtggcg
ctcgatacgctgctgccaccggaacagttgctcgattgcacacaagggatcgagcaaaat
cagggacgcgtccgcaaagctgaacgctgggggccgcggacgttagatctcgatatgctg
acttacggcaatcaggtgatcaacacagaacgtttaacggtaccgcattacgacatgaaa
aatcgcgagttcatgctgtacccgctggccgatctggcaccggaactggtgttccctgac
ggtgaaaccttgcaaagcctgctcgcccgcgtgccgcttaacggtctgacccgatggtaa

DBGET integrated database retrieval system