KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3831Help
Entry
Rahaq2_3831       CDS       T01770                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rahaq2_3831
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rahaq2_3831
Enzymes [BR:raq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Rahaq2_3831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4065661..4067148)
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDILAPWVSDAPAVALKDMILDSRVAAAGDLFVAVSGHTSDGRRFIPQAIAQGV
AAVVAEAKGEQKHGTVCQMHGVPVVYLEDLNILLSELAGRFYQQPGKELRLVGVTGTNGK
TTTTQLLAQWSQLLGETSAVMGTVGNGLLDSVVPAENTTGSAVQVQHILADLVKQGATFA
AMEVSSHGLVQHRVAALPFAAAAFTNLSRDHLDYHGDMQNYEDAKWQLFSSHHVGQKIIN
ADDDVGARWLTKTPGAIAVSMEDKIPAGWNGRWLVARSVNYHDNGATVNIDSSWGEGNLE
SRLMGAFNVSNLLVALATLLSLDYPLAQLLATASQLQPVCGRMEVFNAPGKPTAVVDYAH
TPDALEKALAAARLHCRGTLWCVFGCGGDRDKGKRPLMGGIAEQYADRVIVTDDNPRSEE
PRAIVADILSGLLDAGRAQEIHGRAEAVTSAIMQAKEEDVVLIAGKGHEDYQLVGNQRLD
YSDRVTVARLLGVIA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgacatcttagcgccctgggtgagtgatgccccggcggta
gcgctaaaagacatgattctcgacagccgcgttgcggctgccggcgatctgtttgtcgcg
gtttcaggccataccagtgacgggcgtcgttttattccccaggcaattgcccagggcgtc
gctgccgttgtggccgaggcaaagggtgaacaaaagcatggaacggtctgccagatgcat
ggtgtaccggtagtttatctcgaggatcttaatattctgctgtcagagctggcgggacgc
ttttaccagcaaccgggcaaagaattacgtctggttggcgtaacaggcaccaatggcaaa
accacgaccacgcaattgctggcgcagtggagccagttgctgggcgaaaccagtgccgtg
atgggcactgtgggcaatggcttgctggatagcgtggtaccggcggaaaacaccaccggt
tctgccgtacaggttcagcacattctggctgatctggtgaaacagggggcaacctttgcc
gcaatggaagtttcttcccacgggctggttcagcatcgtgttgctgcactgccgtttgcc
gctgccgcatttaccaacctgagccgtgatcatcttgattaccacggcgatatgcaaaat
tatgaagacgccaaatggcagcttttctcctcgcatcatgtcggtcagaaaatcattaat
gctgacgatgacgtcggagcgcgctggctgacgaaaacgccgggcgcaattgcggtcagc
atggaagacaaaatcccggcaggctggaatggccgctggctggtggcgcgcagcgtgaat
tatcacgacaacggcgcgaccgtaaatatcgattcaagctggggtgaaggcaatctggag
agtcgcctcatgggcgcgttcaacgtcagcaacctgctggttgcgctggcaacgctcctt
tccctcgattatccgctggcgcaattactggcgacagcctctcagctacaaccggtttgt
ggccgcatggaagttttcaatgcgccgggtaaacctaccgcggtggtggattatgcccat
acccctgacgcactggaaaaagcgctggcggcagcccgtctgcattgtcgtggcacgctg
tggtgtgtatttggttgcggcggcgatcgcgataaaggtaaacgtccgctgatgggcggt
attgctgagcaatacgctgaccgcgtgattgttaccgatgataatccccgcagcgaagag
cctcgcgcaattgttgccgatattctctccggcctgcttgatgccgggcgcgcgcaggaa
attcatggccgcgcagaagcagtcaccagcgcgattatgcaggcgaaagaagaggatgtg
gtgttgattgccggtaaaggacatgaggattaccagcttgtcggcaatcagcgtctcgat
tattccgaccgcgtgacggtcgcacgtttgctgggggtgatcgcatga

DBGET integrated database retrieval system