KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3864Help
Entry
Rahaq2_3864       CDS       T01770                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rahaq2_3864
   00670 One carbon pool by folate
    Rahaq2_3864
Enzymes [BR:raq01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Rahaq2_3864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4106561..4107046)
Genome map
AA seq 161 aa AA seqDB search
MIISLIAALATDRVIGMENAMPWHLPGDLAWFKRNTLSKPVIMGRKTFESIGRPLPGRLN
IVISSKPGEHEGVTWVTSVDAALAAAGDVEEVMVMGGGRVYEQLLPKADRLYLTHIDAEV
EGDTHFPDYEPDDWESTFSEFHDADEQNSHGYCFEILDRRA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgattattagcctgatcgccgcactggcgaccgatcgcgttatcggcatggaaaacgct
atgccttggcatttacctggtgatctggcctggtttaagcgtaatacgctcagcaaaccc
gtcatcatggggcgcaagacgtttgagtcaatcggacgcccgttgccaggccggctgaat
attgttatcagctctaaaccgggcgagcatgaaggcgtgacctgggtaacgtctgttgac
gctgcgctggctgctgccggtgatgtggaggaagtgatggtgatgggcggcggccgtgtg
tatgagcagttgctgccgaaggccgaccgtttatatctgacgcacattgatgccgaagtc
gaaggggatacgcatttccctgattacgagccggatgactgggaaagcacattcagcgaa
ttccacgatgcggatgagcagaactcacacggttattgcttcgagatccttgatcgtcgc
gcctga

DBGET integrated database retrieval system