KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3920Help
Entry
Rahaq2_3920       CDS       T01770                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rahaq2_3920
Enzymes [BR:raq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Rahaq2_3920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4175584..4176912)
Genome map
AA seq 442 aa AA seqDB search
MFLAQEIIRKKRDGQPLSDEEIRFFINGIRDSQVSEGQIAALAMTIYFNDMTMNERVSLT
MAMRDSGTVLDWKSLSLNGPVVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDSRFRSIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYSLSEDLAQAIVDVANGAGCKTTALLT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAKDDADARRQL
QAVLDNGKAAEVFGRMIAAQKGPTDFIENYDRYLQQATLSKPVYAEGNGIVSAMDTRALG
MAVVSLGGGRRRASDAIDYSVGLTHMAQLGQQVDTRQPLAMIHANSEAAWQQAAQEVRAA
IVLSDNAPESTPVVYRRIGGNA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctcgcacaagaaattattcgtaaaaaacgtgacggtcagcctttaagtgacgag
gaaattcgtttcttcattaatggcattcgtgacagtcaggtttcagaaggccagattgcc
gcgctggcaatgaccatttatttcaatgacatgaccatgaatgaacgtgtttcgctgacc
atggcgatgcgtgattcagggaccgtgctcgactggaaaagcctcagcctgaacggtccg
gttgtagataaacattctaccggtggcgtgggtgacgtgacctcactgatgcttggcccg
atggtggcggcatgcggcggttatgtcccgatgatttccggccgtggcctcggccatacc
ggcggtacgctcgataaacttgaagctatcccgggctttgatattttcccggatgacagc
cgttttcgcagcatcattcaggatgtcggcgtggcaattatcggccagaccagctcgctg
gcaccggcggataaacgtttctatgcgacacgtgatatcaccgcaaccgtcgattctatt
ccgctgatcaccgcttcgattctcgctaaaaagctggccgaaggcctggatgcattagtg
atggacgtcaaggtcggttccggcgcattcatgccgacttactcgctgtcagaagatctg
gcgcaggcgattgtcgatgtggcgaatggtgcaggttgtaaaaccaccgcgctgctgacc
gacatgaatcaggtgctggcatccagcgcagggaatgcggtggaagtgcgtgaagccgtg
cgcttcctgaccggcgaataccgtaatccgcgtctgctggaagtgacaatggcgctgtgt
gttgaaatgctgctgtccggcggactggctaaagatgacgccgatgcccgccgccagttg
caggccgtgctggataacggcaaagccgcagaagtgtttggccgcatgattgccgcccag
aaaggcccgaccgatttcatcgagaattacgatcgttatctgcagcaggctacgctgagc
aaaccggtttacgccgaaggcaacgggattgtcagcgcgatggacacccgtgcactgggc
atggctgtggtttcactgggtggcggacgtcgccgcgccagcgatgctatcgactacagc
gtcggtctgactcacatggcgcaactgggccagcaggtggatacccgtcagccactggcg
atgatccacgcgaacagtgaagcggcctggcagcaggcggcgcaggaagtgcgtgcggcc
attgtcctgagcgacaacgcgccggaaagcacgccggtggtttaccgccggatcggcggt
aacgcttga

DBGET integrated database retrieval system