KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3928Help
Entry
Rahaq2_3928       CDS       T01770                                 

Definition
putative carbohydrate binding protein
Orthology
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rahaq2_3928
Enzymes [BR:raq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     Rahaq2_3928
    3.2.1.17  lysozyme
     Rahaq2_3928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4182056..4184611)
Genome map
AA seq 851 aa AA seqDB search
MKMNKITQMLCVAGLTMASASAFALEAWNGQEGGDTFEVIFDGSVYSNVWWVGATNCPGT
AEQDQGANPWRKVRSATATEMSQYGNPTVCEIAGDGTQDHYADYDSSHDYLTGDIVLANG
MTYKTSKATPAHSFAPAENNPWVVYAPTPNWSSSATYNQGDKVQKDGVMYEALFYTVNND
PSLPANQNPQGNNGRPWKPSGAVQTYSQEQIDNAPALNINTLYPANSLVKYNGKNYQSAV
IVQKVKPDDISPWAVYMDWTGTKERVGVPKNPWPAQFYAPYVDFTLNMQPDLVGLAKNQN
VNHFTMAFMVAKDANTCVPTWGTAYSVTNYAQYSKIKALREAGGDIMVSIGGANNAPLAA
ACNNVNDLQQHYYDIVENLNLQVLDFDIEGNWLADKESVQRRNAAVKLVQDRWAAEGRHI
GIWYTLPVLPTGLTHEGMEVLQDAKDQGVVLTGINVMAMDYGNAQCQSANTEGQNIHGKC
ATSAIDNLFTQVKGLYPEKSAAQVYAMLGTTPMIGYNDVQGEVFYLSDARLVYQQAKDYG
LGMIGAWSVARDQPGISGQVSAEHSGMTPEQAPMYAYSQIFAPITSGSPAPVETNTPPVA
NAGIAQQVSGTSVITLDGSASTDKEGDTLTYQWKQVSGPAVTLQNSDSAKATFNVAQPVT
NAVYTFSLTVSDGEGSTTAQTSVNVIDASKPVAPSISIDPTYTVNSGESLTLTAKVTDPD
SLPADLHYQWTNPAGLPVAPAQGAASNTEVITAPDVTVDTRFTVDVTVTDNTGLADTATT
TILVKAKTAAGDYEYVYPQSSEKYVAGTRVLGSDGGIYQCKPFPYSGWCSQAAWAYAPAT
GTNWQDAWDKQ
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaataaaatcacacagatgctgtgtgttgccggtctgacgatggcctcggcc
agcgcttttgcccttgaagcgtggaacggacaggaaggcggtgacacctttgaagtcatt
tttgacggcagtgtttactcaaatgtctggtgggtcggtgcaacaaattgcccgggcacg
gcggagcaagatcagggtgcaaatccatggcgtaaagtgcgcagcgcaaccgccacggaa
atgagccagtatggcaatcctactgtgtgtgaaattgccggtgacggtacgcaggatcat
tatgccgattatgacagcagccatgattatttaacgggtgatattgttctggcaaatggt
atgacgtacaaaacgtcaaaagcaacacctgcacacagtttcgcgccggcagaaaataat
ccgtgggtagtttatgcgccgacgccgaactggagcagcagcgctacctataatcagggt
gataaagttcagaaagacggcgtcatgtatgaagcgctgttctataccgtaaataatgat
ccgtcccttcctgccaatcagaatcctcagggaaataatggccgtccgtggaaaccgtca
ggggcggtacaaacctattcacaggaacaaattgataacgcaccagcgttaaatattaat
acattatatcctgctaattccttagtgaaatataacggtaagaattaccagtctgctgta
atagttcagaaagtgaaacctgatgatatttcaccgtgggctgtctatatggactggacc
ggcaccaaagaacgtgttggcgtgccgaaaaatccatggcctgcacagttctatgcgcca
tacgttgatttcaccttaaatatgcagcctgacctggtgggtttggcgaaaaaccagaac
gttaatcatttcaccatggcctttatggtcgctaaagacgccaatacctgtgtgccgaca
tgggggaccgcttacagcgtgaccaattacgcacagtacagcaaaatcaaagcactacgt
gaagcgggcggcgatattatggtgtcgatcggcggtgcgaacaatgcccctctggccgca
gcctgtaataacgtgaatgacctgcaacagcattattatgacattgtcgaaaacctgaac
ctgcaggtgcttgacttcgatatcgaaggcaactggctggctgataaagaatctgttcag
cgccgtaatgctgctgtcaaattagtgcaggatcgctgggctgccgaaggccgtcacatc
ggtatctggtataccctgcccgttctgccaaccggtttaactcacgaagggatggaagtg
ttgcaggatgccaaagatcagggcgtcgtgctgaccgggattaacgtgatggcgatggat
tacggcaacgctcaatgtcagtcggccaacactgaaggtcagaatattcacggtaaatgt
gctacgtccgccattgataatctgttcactcaggtgaaaggtttataccctgagaagagt
gccgcacaggtttacgccatgctgggaacaacgccgatgattggctataacgatgtgcag
ggtgaagtgttctatctttccgatgcacgtctggtctaccagcaggcgaaagattatggc
ctgggtatgatcggtgcgtggtctgtggcccgtgaccagccgggtatttcagggcaagtt
tcggcggaacacagtggtatgacgccggaacaggctccgatgtacgcttacagtcaaatc
tttgcgccaatcaccagcggttcaccggcgccggtagaaaccaatacgccgccggtggct
aatgccggtattgctcagcaagtcagcggaacctccgtcatcacgctcgacggttcagcc
agcacggataaagaaggcgataccctgacgtatcagtggaagcaagtttccgggccggca
gtgacgctgcaaaacagcgactcggcaaaagcgacattcaacgtggcgcaaccggtgacc
aatgcggtatataccttctcgctgaccgtaagtgacggcgaaggcagcaccacagcgcaa
accagtgtgaatgtgattgatgcgtctaaacccgttgcaccctcaatatcaatcgaccct
acgtataccgtaaattctggcgaatcgctgaccctgacagcaaaagtcaccgatcctgat
tcgctgccggctgacttacattatcagtggacgaatccggcaggattgccagtggcaccg
gctcagggagcggcgtccaatacggaagtgatcaccgcaccggatgtgaccgtcgatacg
cgcttcactgtcgacgtgaccgtcaccgataacaccggtttagcggacaccgccaccacc
accattctggtgaaagccaaaactgcggcaggggattatgaatatgtttatccgcaaagc
agcgaaaaatacgtagcgggcaccagggtcttaggcagtgatggtggtatctatcaatgc
aagcctttcccgtactccggttggtgtagtcaggcggcctgggcatatgcacctgcgacc
ggcacgaactggcaggatgcgtgggataaacagtaa

DBGET integrated database retrieval system