KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4007Help
Entry
Rahaq2_4007       CDS       T01770                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:raq00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:raq00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4267777..4268712
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKDIISINDLSREELELVLDTAASLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSSNTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GGIPVLNAGDGANQHPTQTLLDLFTIQETQGRLDNIKIAMVGDLKYGRTVHSLAQALAKF
NGNRFYFIAPDALAMPGYILALLEEKGIEYSLHSSIDEVVSEIDILYMTRVQKERLDPSE
YANVKAQFVLRAADLTHAQPHLKVLHPLPRIDEITPDVDKTPYAWYFQQAGNGIFARQAL
LALVLNADTAQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccaatccgctgtatcagaaagatatcatttccatcaacgatctcagccgcgaagag
ctggaactggtactcgataccgctgccagcctgaaagccaacccgcagcctgaattgctg
aaacacaaagtgatcgccagttgtttcttcgaagcctcaacccgcacacgcctgtcattt
gaaacgtcaatgcatcgtctgggtgcctcggtggtgggtttctccgacagcagcaacacg
tcgctcggtaaaaaaggcgaaacgctggccgataccatttcggttatcagcacctacgtc
gatgcgattgtgatgcgccatccgcaggaaggtgcggcgcgtctggcgaccgagttctcc
ggcggtattccggtactgaacgccggtgacggtgcaaaccagcacccgacgcaaaccttg
ctggatctgttcaccattcaggaaacgcaggggcgtctcgacaacatcaaaatcgccatg
gtcggcgacctgaaatatggccgcacggtgcattccctggcgcaggcactggcgaaattt
aacggcaaccgcttttactttatcgcaccggacgcgctggcgatgccgggatatatcctg
gcgttactggaagaaaaaggcatcgaatacagcctgcacagcagcattgatgaagtggtc
tctgaaatcgacattctgtacatgacccgcgtgcagaaagagcgtctggatccgtcggaa
tacgccaacgtgaaagcgcagtttgtcctgcgggctgccgatctgacccatgctcagccg
cacctgaaagtgctccacccgctgccgcgtatcgacgaaatcacgccggatgtcgataaa
acgccttatgcctggtatttccagcaggccggtaacggcatttttgcgcgtcaggctttg
ctggcgctggttctgaacgcagacactgcacagtaa

DBGET integrated database retrieval system