KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4030Help
Entry
Rahaq2_4030       CDS       T01770                                 

Definition
glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rahaq2_4030
Enzymes [BR:raq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Rahaq2_4030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4293783..4295462)
Genome map
AA seq 559 aa AA seqDB search
MDAIQGLLKEIYAGKLSPVFLDDLMTRIEVARNQIAYTAKQGWDEKDVVLITYADQFTHK
AEKTLSVFDGFYQRHLADVFNIVHLLPFYPYSSDDGFSVIDYQQVNPLAGDWKDIRKLGQ
SSRLMFDYVCNHISASSEWFKQYLAGNPKYENYFISLDENSDLSAVTRPRRSPLLTPFRC
ENGETRHVWTTFSADQIDLNFAHPDVLRDMLDVLLKYLSEGAEYVRLDAVGYMWKEPGTS
CIHLPKTHLLVKLFRAVVDYVSPGTVIITETNVPHQDNISYFGNGADEAQMVYQFPLPPL
VLHAIHSENGETLKRWAAGLGACTPATTFFNFFASHDGIGLNPLRGLLPEPEILRLVDAL
QQEGARVSYKNNPDGSTSPYEVNVTYMDALNRQADDDDIRLQRFMLAHAILLAFPGVPAV
YIQSILGSRNDIHGVESAGHNRAINRQKYDVTEIEQILSEPDSLRARVFSELKKLITCRT
EQAAFHPSAPMHIIECHESVFAFIRGQGNEEIMCLFNLSAKHIQASLPSGGYQVLPYHHS
LECDGEITLKPYQYIWLRH
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggacgctattcagggattactgaaagagatatatgcagggaaactgtcaccggtattc
ttagatgatctgatgacacgcattgaagttgccagaaatcagattgcctatactgccaaa
cagggatgggatgaaaaagatgtggtattgatcacctatgctgatcagttcactcataaa
gcagaaaaaacactttcagtattcgatggtttttatcagcggcatctggcggatgttttt
aatattgtacaccttctgccattttatccttattcgtcggatgacggtttctcggtgatt
gattatcagcaggtcaatccgctggcgggggactggaaagatatccgtaagcttggccag
tcttcacggctgatgtttgattatgtctgtaatcatatttccgcgagcagtgaatggttt
aaacaatatctggcgggcaatccgaaatatgaaaactattttattagcctggatgaaaac
agtgacttatctgcggtgacccgcccccggaggtcaccgctgttaacgcctttccgctgt
gaaaatggcgaaacccgtcatgtctggaccaccttcagcgcagatcagatcgacctgaac
tttgcacatcctgacgtactgcgtgacatgctggacgtgttgctgaaatacttgtcggaa
ggggctgaatatgtgcgtctcgatgcggttggctacatgtggaaggaacccggcacctcc
tgtattcatctgcccaaaacacatttactggtgaagttattccgcgccgtggtggattat
gtttcacccggtaccgtgattattactgaaaccaatgtgccgcatcaggacaatatcagt
tacttcggtaacggtgctgacgaggcgcagatggtttatcagttcccgctgccgccgctg
gttctgcacgccattcacagtgaaaacggcgaaacgctgaaacgctgggccgccggtctt
ggcgcttgtacgcctgcgaccaccttctttaatttctttgcttcgcacgacggtatcggt
ctgaatccgttacgcggattattgccggaaccggagatcctccggctggtggatgcgctg
caacaggagggcgcgcgggtgtcgtataaaaataatccggatggcagcaccagcccgtat
gaagttaacgtcacctatatggatgcgctgaaccggcaggcggacgacgacgatatccgt
ctgcaacgcttcatgctggcacacgctattttgctggcattccccggtgttcctgcggtg
tatattcaaagtattctcggttcgcgtaacgatattcacggggtagaaagcgccgggcat
aaccgggcaattaaccggcagaaatatgatgtcacggaaattgaacagatattgtctgaa
cctgattcattacgtgcgcgggtatttagtgaactgaaaaaattaattacctgcagaact
gaacaagcggcatttcacccttccgccccgatgcacattatagaatgtcatgaaagcgtg
tttgcctttatccgcggacagggtaacgaagaaataatgtgcctgtttaacctttccgct
aaacatattcaggcctctctcccttcagggggttatcaggtcttaccttatcatcattca
ctggaatgtgacggggaaataacattaaagccttatcagtatatctggttacgtcattaa

DBGET integrated database retrieval system