KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4227Help
Entry
Rahaq2_4227       CDS       T01770                                 

Definition
(GenBank) Protein of unknown function (DUF1481)
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1481
Motif
Other DBs
NCBI-ProteinID: AEX53989
UniProt: H2IV75
Position
complement(4501185..4501880)
Genome map
AA seq 231 aa AA seqDB search
MKRISGGAFQPLQFITPGLVAGLLVLGLVGCSSKKDPELFFASGYVADQGINRLWREDSA
QHEPQTILNVYSPYYGGDTIITRYEFQQGQLHLIKETHATKTDLGVMLRFDEGGNVSFMQ
RQLPERREKLSSDEIERYKYEASKTLDLSNALQAGNVRLVQARWRKGLITTCAGEQVTPT
LTVRSQVWLAKRASRSNDNLGLAWLTAPQGNELLLVANEDFCKWEPKESDL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagaataagcgggggggcctttcagccccttcagtttatcacccccggactggta
gcaggtttactggtgctcggtctggtgggttgcagttctaaaaaagatcctgagttattc
tttgccagtggctatgtcgctgatcaaggcatcaaccggctctggcgcgaagacagcgca
cagcacgagccacaaaccattctcaacgtctatagcccctattatggcggcgatacgatt
attacccgctacgaattccagcaagggcaattgcacctgattaaagaaacccatgcgacc
aaaactgatttgggcgtcatgctgcgttttgacgagggcggcaacgtcagttttatgcag
agacagcttccagagcgtcgggagaaattatcttcagacgaaattgaacgctataaatat
gaagcgtcaaaaaccctcgacctgagcaatgcgctgcaggcaggaaatgtccggctggtt
caggcccgctggcgcaaaggattaataacgacctgcgcaggtgaacaagtcacgccgaca
ctgactgtccgttcacaggtctggctggcgaaacgggccagtcgcagtaacgataatctg
ggcttagcctggctgacggccccgcaaggcaacgaactgttactggtcgccaatgaagat
ttttgtaaatgggaaccgaaagagtcagatctctga

DBGET integrated database retrieval system