KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4234Help
Entry
Rahaq2_4234       CDS       T01770                                 

Definition
(GenBank) hypothetical protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEX53996
UniProt: H2IVU1
Position
complement(4506323..4506487)
Genome map
AA seq 54 aa AA seqDB search
MGGAAQAALCRQMPDCAERITLLLFPSRVLTRSGSADPELTVSAWRNLHEKIMR
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgggcggagcagcacaggcggccttatgcaggcagatgccagattgcgctgaacgcata
acattactcttgttcccttcgcgggtactaacccgatcaggttccgcggatcccgaatta
acggtctcagcctggcgtaatctccatgagaagattatgcgctag

DBGET integrated database retrieval system