KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4237Help
Entry
Rahaq2_4237       CDS       T01770                                 

Definition
(GenBank) dinucleotide-utilizing enzyme possibly involved in molybdopterin or thiamin biosynthesis
  KO
K03148  
sulfur carrier protein ThiS adenylyltransferase [EC:2.7.7.73]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rahaq2_4237
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Rahaq2_4237
Enzymes [BR:raq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.73  sulfur carrier protein ThiS adenylyltransferase
     Rahaq2_4237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4509161..4509910
Genome map
AA seq 249 aa AA seqDB search
MLNDAAFMRYSRQLMLEEFGPQAQEKLQAAKVLIVGLGGLGSPAALYLAAAGVGTLFLAD
DDQLHITNLQRQILYRTADLDQPKAALAKRELLRLNPLCEAVAITERLAGEALTRAVSGA
DIVLDCSDNMATRHAVNKACVDAGKTLISGSAVGFSGQLLVIEAPYAHGCYACLYPDQET
VQRNCRTSGVLGPVVGTLGTLQALEALKILAGLPSVLSGKLRLFDGKTQNWRSLQLTRSS
ACVICGGYA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcttaacgatgccgcttttatgcgctacagccgtcagctgatgctggaggaattcggt
ccgcaggcacaggaaaaattacaggcggcgaaagtactgattgtcggccttggtggtttg
ggttctcccgcagccttgtacctggcagcagcaggcgtcggcacgctttttctggccgat
gacgatcaactgcatatcaccaatcttcagcgacaaattctctatcgcacagcggatctc
gatcagcccaaagccgctctggcaaagcgtgaactgctgcgcctgaatccgctttgcgaa
gccgtggcaatcacggaacgtctggcaggcgaagcgttgacccgtgccgtatcgggcgcc
gatatcgttttagattgcagcgataacatggccacccggcatgcggttaataaagcttgt
gtggatgccggtaaaaccttgatcagcggcagtgccgtcggattcagtgggcagcttctg
gttatcgaagccccttacgctcacggctgttatgcctgtttatatccggatcaggaaacc
gtgcagcgcaactgccgcacatccggcgtactcggaccggtggtcggtaccctcggtaca
ttgcaggcactggaagcactgaaaattctggctggcctgccttctgtgctgagcggcaaa
ttacgtctgttcgacggcaaaacgcaaaactggcgttcactgcaactcacgcgttcatca
gcctgcgtcatctgcggaggctacgcatga

DBGET integrated database retrieval system