KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4280Help
Entry
Rahaq2_4280       CDS       T01770                                 

Definition
(GenBank) hypothetical protein
  KO
K09760  DNA recombination protein RmuC
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RmuC LapA_dom
Motif
Other DBs
NCBI-ProteinID: AEX54033
UniProt: H2IVX8
Position
complement(4553733..4555274)
Genome map
AA seq 513 aa AA seqDB search
MDISILTALGAGLMGLLLGWLIASLRQQQQQTEYETQRRLLEQSLEQVKAENDTHKSERL
SGQQQLREAELELRKLHSLQAASQEKLQLLAHWQNECEQLNQELRAQREINSAQEAELRE
VSTRLDETRMAAEEKQRLLINSEQRLSSQFENLANRIFEQNGRRADEQNKQSLDKLLLPL
REQLDGFRRQVQDSFGQEARERHTLAHEIRNLQQLNVEMAREAVNLTKALKGDNKTQGNW
GEVVLSRVLEASGLREGYEYQTQVSVQVDSNSRMQPDVVVRLPQNKDVVIDAKMTLVAYE
RYFNSEDDSEREVALNEHIASVRGHIRLLGRKDYQQLPGLRSLDYVLMFIPVEPAFLLAI
DREPELISEALRHNIMLVSPTTLLVALRTISNLWRYEHQSQNAKRIADRAARLYDKLRLF
VDDMESMGQSLDKAQGSYRSAMNKLSQGRGNLIGQVESFRALGVEVKRPISPSLAEIAKA
ENEPENTASLPDTSDAEEEQTRNPDELTPHEQA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtggatatcagcattctgactgccctgggggcggggttaatgggcttactcttaggttgg
ctgatcgccagtttgcgacaacagcaacagcagacggagtatgaaacgcagcgccgtttg
ctggaacaatcgctggaacaggttaaagcagaaaatgatacgcacaaaagcgagcggcta
tcaggccagcagcaactgcgtgaggctgaacttgagttgcgaaaactgcacagcctgcag
gcggccagccaggaaaaattacaactacttgctcactggcaaaacgagtgtgagcaactg
aatcaggaactgcgtgcgcagcgggaaatcaacagcgcgcaggaagcagagttgcgtgag
gtttcaacccgtctggatgaaacccgtatggcggctgaagaaaagcagcgtctgctgatt
aacagcgaacagcgcctgagcagccagtttgaaaatctggctaaccggattttcgaacaa
aatggccgtcgtgccgacgaacaaaacaagcaaagtctcgacaagttactgctgccgttg
cgcgaacaactggatggttttcgccgtcaggtgcaggacagcttcgggcaggaagctcgt
gagcgacatacgctggcgcatgagatccgcaatctgcagcaactgaatgtggagatggcg
cgtgaagccgtcaacctgaccaaggccctgaaaggcgacaataaaacgcagggcaactgg
ggggaagtggtgctgagtcgtgtgctcgaggcctccggtttacgcgaagggtatgaatac
cagacgcaggtcagcgtgcaggttgacagcaacagccgcatgcaacctgatgtggtcgta
cggttaccgcagaataaagacgtggtgattgacgccaaaatgacgctggtcgcgtatgag
cgctatttcaacagcgaggatgacagcgagcgggaagtggcactcaatgaacatattgcc
tcggtgcgcgggcatatccgcctgctcgggcgtaaagattaccagcaacttcctggtctg
cgcagcctcgattatgtgctgatgtttattcccgttgagcccgcttttctgctggctatc
gaccgtgagcctgaattgatcagcgaagcgctccgccacaatattatgctggtcagcccg
acgaccctgctggtggcgctgcgcactatcagcaacttatggcgctatgagcatcagagc
cagaacgccaaacgtatcgccgaccgtgcggcacgtctttacgacaaactgcggctgttt
gtggatgacatggagtcgatggggcaaagtctcgacaaagcgcagggaagttatcgatcc
gcgatgaataaactctcgcaaggccgtggtaatcttatcgggcaggtggaaagtttccgc
gcgctgggtgttgaagttaaacggcctatcagtccttctctggctgaaatagcgaaagcg
gaaaatgaacctgaaaataccgcatctctgcccgatacctctgatgcggaagaagaacag
acgcgtaacccggatgagttaacgcctcacgagcaggcatag

DBGET integrated database retrieval system