KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4283Help
Entry
Rahaq2_4283       CDS       T01770                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00380  Tryptophan metabolism
raq00630  Glyoxylate and dicarboxylate metabolism
raq01110  Biosynthesis of secondary metabolites
raq01130  Biosynthesis of antibiotics
raq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rahaq2_4283
  Amino acid metabolism
   00380 Tryptophan metabolism
    Rahaq2_4283
Enzymes [BR:raq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     Rahaq2_4283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI AKAP2_C
Motif
Other DBs
NCBI-ProteinID: AEX54036
UniProt: H2IVY1
Position
complement(4557108..4559450)
Genome map
AA seq 780 aa AA seqDB search
MEDLQNVHRTPETFVEELCSMSKLPAKTTQKSESKSVSRAPATGIESSQPGLGDLAPGDR
AYQPSPQPTPPGKEPTAPGSAKSPKNTNAKLDALERHRKNGEKQPLTTNQGTKIADDQNS
LKAGSRGPTLLEDFILREKITHFDHERIPERIVHARGAAAHGYFQPYRSMKDVTKASFLS
DPEQKTPVFVRFSTVQGSRGSADTVRDIRGWATKFYTDEGIYDLVGNNTPVFFIQDAHKF
PDFVHAVKPEPHNEIPQGASAHDSFWDYVSLQPETLHNVFWAMSDRGIPRSYRTMEGFGI
HTFRFVNAEGKATFVRFHWKPLAGKASLLWDEAQKLAGKDADFHRRDLWEAIEAGDYPEY
ELGVQLIPEEDEFKFDFDLLDPTKLIPEKLVPVELIGKMVLNRNPDNFFAETEQAAFHPG
HIVPGIDFTNDPLLQGRLFSYTDTQISRLGGPNFHEIPINRPTCPFHNFQRDGMHRQDID
TNPANYEPNSLNNNWPRETPPAASGGGFESYPERVDAEKIRQRSPSFAEYYAHPRLFWLS
QTPAEQDHIVGAFSFELSKVARPYIRERVVDLLAHVDQTLAQKVAKNLGITLSAEILKIK
PPKPVNGLKNDPSLSLYASGKGTIKGRQVAILLGEGVNAADVLETLQAFQAAGVHPKLLA
SHLGNVTADDGSTLPVDATFAGSPSITVDAVIVPHGHIDALLMNGDARHYVLEAYKHLKV
VGLSGDARRFKSLLGLTDGVPEEGVVEGEKAEGALLKTFLDDMHKHRIWSRSAAADAVPA
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggaagatttacagaacgtccacagaacacccgaaacctttgtcgaggagctatgttca
atgtcaaaattacccgctaaaacgacccagaaaagtgagtccaaatcggtaagccgcgcc
cccgccacgggcattgagtcttcgcagccaggcctgggcgatcttgcgccgggcgatcgt
gcttatcagccttcgccacaaccgacaccgccaggaaaagaaccgaccgctcccggcagc
gccaagagtccgaaaaataccaatgccaagcttgatgcattagaacgccaccgtaagaac
ggcgaaaagcagccgctgaccaccaatcagggcaccaaaattgctgatgatcagaactcg
ctgaaagccggaagccgtggcccgacactgcttgaagatttcatccttcgcgaaaaaatc
actcattttgaccatgagcgcatccctgaacgtatcgttcatgcacgcggtgcagcggcg
cacggttattttcagccataccgcagtatgaaagacgtgactaaagccagtttcctctca
gaccccgaacagaaaacaccggtctttgtgcgattttctaccgtgcagggctcccgtggc
tcggcagataccgtgcgcgatatccgcggctgggcgaccaagttttatacggatgaaggg
atttacgatctggtgggtaacaatacgccagtgttctttattcaggatgcccataaattc
cctgactttgtacatgcggtcaaacccgagccgcacaacgaaatcccgcaaggcgcgagt
gcgcacgattccttctgggattacgtatccctgcaaccggaaacgctacataacgttttc
tgggcaatgtctgatcgtggtattccgcgcagttatcgcacaatggaaggcttcggcatt
cataccttccgcttcgtgaatgcagaagggaaagccacttttgtccgttttcactggaaa
ccgctggccggaaaagcctcgctgttatgggatgaagcacagaaactggccgggaaagat
gccgatttccaccgccgtgatttgtgggaagccatcgaagcgggggattatccggaatac
gaactgggggttcagctgattcccgaagaagacgagttcaaatttgatttcgatctgctc
gacccgaccaagctgatccctgaaaaactggtaccggtagaactgatcggcaaaatggtg
cttaaccgtaatcccgataatttctttgccgaaactgagcaggccgcattccacccggga
cacatcgtgccgggcatcgatttcaccaatgatccgctgttacagggccgattgttctct
tacaccgacacgcaaatcagccgtcttggcgggcctaatttccatgaaattccgattaac
cggccgacgtgtcctttccataacttccagcgtgacggcatgcatcgtcaggacattgat
acgaatccggcgaattacgagccgaactccctcaacaataactggccgagggaaacgcct
ccggcagcatccggcggcggttttgaaagttatcctgagcgggttgatgcagaaaaaatc
cgccagcgcagcccgtcatttgccgaatactatgcccatccgcgcctgttctggctgagc
cagacaccggcggagcaggatcatattgtcggcgccttctcatttgaattatcaaaggtg
gcgcgaccgtatatccgcgagcgtgtagtggatctgttggcgcatgttgatcagacgctg
gcgcagaaagtggcgaaaaatctcggcattaccctttccgctgaaatcctgaagatcaaa
ccgccgaagcccgttaacgggctgaaaaatgatccgtcactgagtttgtatgccagcggt
aaaggcacgatcaaagggcggcaggtcgcgatattgctgggcgaaggtgtgaatgcggcg
gatgttctggaaaccttacaggcatttcaggccgctggcgttcatccgaagctgctggcc
agtcatttaggcaatgtgactgccgatgatggttccacgctgccggttgatgccacgttt
gccggatcgccttccatcaccgttgatgcagtgattgttccgcacgggcatatcgacgca
ctgctgatgaatggtgatgcgcggcattacgtgctcgaagcctacaagcacctgaaagtg
gtgggcctaagcggtgatgcgcgccgcttcaaatcgttgctggggctgacggatggagtg
ccggaagagggcgttgtcgaaggcgaaaaagccgaaggcgcattactgaaaaccttcctc
gacgacatgcataaacatcggatctggtcgcgcagtgcggcagcagatgctgttcctgcc
tga

DBGET integrated database retrieval system