KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4289Help
Entry
Rahaq2_4289       CDS       T01770                                 

Definition
(GenBank) pyruvate formate-lyase
  KO
K00656  
formate C-acetyltransferase [EC:2.3.1.54]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rahaq2_4289
   00640 Propanoate metabolism
    Rahaq2_4289
   00650 Butanoate metabolism
    Rahaq2_4289
Enzymes [BR:raq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Rahaq2_4289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4565490..4567787
Genome map
AA seq 765 aa AA seqDB search
MTARTERLKAALFASPREISLERALLYTESYRSTEGEPTLLRRAKATAYILDNVEIALRE
DELIAGNRTVKPRAGIISPEMDPYWLLKELDTFSTRPQDRFNISEQDKQIYRGQLFPYWE
SHSMKDFINSQMPEEVKAATQTQIFSINQTDKGQGHIIIDYPRLLNSGLDKVVSALQQHV
AGTPDNVFYQAALMTLQAAQRHILRYAALAEALAEACQDETRKQELARIACISRHISANR
PQDFYQACQLFWYMNIILQIESNASSLSLGRFDQYMLPFYQHSLSHGESPAFLQELLESL
WVKCNDIVLLRSTASARYFAGFPTGYTILLGGLTDTGRSAVNVLSFLCLDAYQRVCLPQP
NLGVRVNELIDRPFLLKTAETIRLGTGIPQIFNDEVVVPAFLNRGVNLEDARDYAVVGCV
ELSIPGKTYGLHDIAMFNLLKVMELTLHENEGNAAITYPELVQQIRQKISHYVRLMAQGS
NICDIGHRDRAPVPLLSSFIEGCLDSGKDITAGGARYNFSGVQGIGIANLSDSLHALKGM
VFDQQRLTFDELLTSLRENFASEEGRAIRARLIHRFEKYGNDIDEVDLISADLLRFYCKE
VEQYRNPRGGQFTPGSYTVSAHVPLGAVVGATPDGRFAGEQLADGGLSPMLGQDHQGPTA
VLKSVSKLDNMLLSNGTLLNVKFTPSTLEGQQGLNKLADFLGAFTRLKLQHIQFNVVNAE
QLLEAQKRPQDFAGLVVRVAGYSAFFVELSKEIQNDIIGRTAHQL
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccgtacagaacgtctgaaagctgcacttttcgccagcccgcgtgagatctcg
ctggaacgggccctgctgtatactgaaagttaccgcagcacagaaggcgaacccacgctt
ttgcgccgcgcgaaagccacggcctacattctggataatgttgagattgccctgcgtgag
gacgaactgattgccggcaaccgtacagttaaaccgcgtgcggggatcatctcgcctgaa
atggacccctactggctgctgaaagagctggacacgttttccacccgcccgcaggaccgt
ttcaacatttctgagcaggacaaacagatttaccgcgggcagcttttcccttactgggaa
tcgcattcgatgaaagatttcatcaacagccagatgccggaagaggtgaaagcggccacc
caaacgcagattttcagtatcaaccagactgataaaggtcaggggcacatcattatcgat
tatccccgcctgctgaattctggcctggataaggtagtgtcagcgcttcagcagcacgtt
gccggtacgcctgataatgtcttttatcaggcagcgctgatgacactgcaggcagcacag
cggcatattttgcgctacgccgcgctggcagaagcgttagcagaagcctgtcaggatgaa
accagaaaacaggaactggcgcgtattgcctgcatttcgcgtcatatttcggccaacagg
ccacaagatttctatcaggcctgtcagctgttctggtacatgaatatcattttgcagatt
gaatccaacgccagttctttgtcgctcgggcgcttcgatcaatacatgctgccgttctat
cagcattctctttcgcacggcgaatcaccggcgtttcttcaagagttgctggaaagcctg
tgggtaaaatgcaatgacatcgtgctgctgcgctcgaccgccagcgcacgttacttcgcc
ggattcccgacgggttacaccattttactcggtggcctgaccgataccggccgcagcgcc
gtcaatgtcctgtcgtttttgtgtctggatgcctatcagcgtgtttgcctgccacagccc
aaccttggcgtgcgggtcaatgaactgatcgaccgcccgttcctgctgaaaaccgccgaa
acgatccgtcttggcaccggtattccgcaaatattcaatgatgaagtggtggttccggcg
tttctcaatcgcggcgtaaatctcgaggatgcgcgggattatgcggtagtaggctgcgtc
gaattatccattcctggcaaaacctacgggctgcacgatatcgccatgtttaacctgcta
aaagtcatggagctgacgctgcatgaaaacgagggcaacgcggcgataacgtaccctgaa
ctggtacaacaaatccggcagaaaatcagccattacgtcaggctgatggcacagggcagc
aatatctgtgatatcggccaccgcgaccgggcaccggtgccgctgctgtcttcgtttatt
gaaggttgtctggacagcggcaaagacatcaccgcgggcggcgcccgttataacttttcc
ggtgttcagggtatcggcatcgccaacctcagcgattctctgcatgcgctgaaaggcatg
gtgtttgatcagcaacgcctgacctttgatgaattactgacttcgctgcgggagaatttt
gccagcgaagaaggtcgcgccattcgtgcccgtctgatacaccgctttgagaagtatggt
aatgacattgatgaagtcgatttgatcagtgcggatttgctgcgtttttactgtaaggaa
gtcgagcagtatcgcaatccgcgcggcggtcagtttacgccgggttcttataccgtttcc
gcacacgtacctttgggtgcagtagtcggcgcaacgccggatggccgttttgccggtgaa
caactggcggatggcgggctttcgccgatgctgggacaggaccatcaggggccgactgcg
gtactcaaatccgtcagtaaactcgacaatatgttgctctccaacggcacgctgctgaat
gtgaaattcacgccatcgacgcttgaaggccagcaggggctgaataaactggctgatttc
ctcggcgcatttacccgccttaaattgcagcatattcagtttaacgtggtgaatgccgaa
cagcttctcgaagcgcaaaaacgcccgcaggattttgcggggctggtcgtcagggtggcg
ggatacagcgcattctttgttgagctgtcaaaggagatccagaatgacatcattggccgt
accgcgcatcagctctga

DBGET integrated database retrieval system