KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4291Help
Entry
Rahaq2_4291       CDS       T01770                                 

Definition
(GenBank) PTS system, fructose-specific, IIB component
  KO
K11202  
PTS system, fructose-specific IIB-like component [EC:2.7.1.-]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Module
PTS system, fructose-specific II-like component
Brite
Enzymes [BR:raq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     Rahaq2_4291
Transporters [BR:raq02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II-like component [MD:M00306]
    Rahaq2_4291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4568666..4569010
Genome map
AA seq 114 aa AA seqDB search
MSLKLVAVTACISGVAHTYMAAEKLEKLCLHEKWPVKVETQGALGIENALSENDIAQADI
VLLVTEIQLENSERFAHNRCVQTGIHTFLRTPEKVMAAVKKLATSPQGTKIVLP
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcaaactggtcgccgtaaccgcctgtatcagcggtgtggcgcatacttatatg
gcggcagaaaagctggaaaaactgtgcctccacgaaaaatggccggtgaaagtcgaaacg
cagggtgcgctgggcatcgaaaacgcactctcagaaaacgacattgctcaggcagacatt
gttctgttagtcactgaaattcagctggaaaacagcgaacggtttgcacataaccgctgc
gtccagaccggcattcacacctttttacgcacgccggaaaaagtgatggcagccgtaaag
aaactcgccacatcgcctcagggaacgaaaatcgttctcccctga

DBGET integrated database retrieval system