KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4294Help
Entry
Rahaq2_4294       CDS       T01770                                 

Definition
(GenBank) Carboxylate/Amino Acid/Amine Transporter
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4572421..4573320)
Genome map
AA seq 299 aa AA seqDB search
MPLLIITTILWAFSFSLIGVYLAGQVDSVFSVLVRLGLAALVFLPFLRWKGHQLTTILLY
MAVGAMQLGIMYLISFEAYLYLSVPEFLLFTVMTPLYVTLIYDLISGRKIRMGYALSALL
AVAGAAIIRYDHISEHFIIGLLLVQAANICFAIGQVGYKRLMETRPVPQHTAFSWFYLGA
LLCAVVAWFLWGNPQKLPTTNLQWGILVWLGIGASGLGYFMWNYGATQVDAGTLGIMNNF
HVPAGLLVNLAIWQQQPHWPSFIIGAAVIMSSLWVHRRWVVPRREQTADDRTRAAAPNE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgcctttactcatcatcaccaccattttgtgggccttttccttcagcctgattggcgtg
tatctggccggacaggtcgatagcgtgttctccgtgttagtccgtttagggctggcggcg
ctggttttcctgccgtttttacgctggaaaggccatcagctcaccaccattttgctgtat
atggcggtgggggcgatgcagctcgggatcatgtatctcatcagcttcgaagcttatctg
tacctgtcggtaccggaattcctgttgtttacggtcatgacgccgctgtatgtcacgctg
atttatgacctgatcagcgggcggaaaatccgcatgggctatgcgctcagcgcgctgctg
gcggtagccggggcggcgattatccgttacgaccatatcagcgaacatttcatcatcggt
ttgctgctggtgcaggcggcgaatatctgttttgccatcgggcaggtgggatacaaacgt
ctgatggaaacccgtccggtgccgcaacatacggcgttttcctggttctatctgggggcg
ttgctttgcgcagtggtggcgtggttcctgtggggaaatccgcaaaaactgccgaccacg
aatttacagtggggcattctggtgtggctggggatcggggcttcagggctgggatacttc
atgtggaactacggggcgacgcaggttgatgcgggaacgttggggattatgaacaacttt
cacgtcccggccgggctgctggtgaatctggcgatctggcaacagcagccgcactggccg
agctttatcatcggtgccgctgtgattatgtcctcactgtgggtacaccggcgttgggtc
gtgccgcgtcgcgaacaaacggcagatgatcgcacgcgtgctgccgcgccgaacgaataa

DBGET integrated database retrieval system