KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4301Help
Entry
Rahaq2_4301       CDS       T01770                                 

Definition
(GenBank) transcriptional regulator with HTH domain and aminotransferase domain
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4579119..4580306)
Genome map
AA seq 395 aa AA seqDB search
MNTEGLLAARMVRLKSSAIRELLKHSKMEGVISLAGGIPSSALFDFDGLREATQLAITEQ
PEHAFQYGLTEGSYTLRERIAELCQERGVVASPDDIVVTAGSQQALDLVMRAVVNPDDIF
VVERPTYLAALQTLELAEARLLSVGSDGDGMIVDELAELLKTQKIKGVYLVPTFGNPSGV
TLSRARREQLVKLAAQYEFLIVEDDPYGELRFTDERQPTLFELSKALFGHADNIIYTSTF
SKILAPGLRLGWVIMPDWLLHKVAIIKQAADLHASALSQTIAEYYLGLGRLPKQIETIRA
AYKNKCQIMAGLLERELGDVLTFEYPKGGMFLWARFREPRNCAEWMKKTLEQGVVFVPGE
FFYADNPDHSTFRLSFATATEEQMHEAVARLKRAL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagaaggtttactcgccgcccgtatggtcaggcttaaaagttcggccatccgg
gaattgctgaaacacagcaagatggaaggcgttatttcgctggcgggtggtattccttct
tcggcgctttttgatttcgacggcctgcgtgaagccacgcaactggctatcactgaacag
ccggaacacgcttttcagtatggtctgaccgaaggcagttatacgctgcgtgagcgtatt
gctgagctttgtcaggaacgtggcgtggtcgccagcccggatgatatcgtggtcaccgca
ggctcccagcaggcgctggatctggtgatgcgtgcggtcgtcaatccggatgatattttt
gtggttgaacgcccgacgtatctggcggcgttacagacgctggaactggcggaagccagg
ctgttgtccgtcggttctgacggcgatggcatgattgttgatgagctggcggagctgctg
aaaacgcagaaaatcaaaggggtgtatctggttccaactttcggaaacccgagcggcgtg
accctgagccgtgcccgtcgtgaacagttagtaaaactggcagcacagtatgaattcctg
attgtggaagatgacccgtacggcgaactgcgtttcaccgacgaacgccagccgacgctg
tttgagctgtcgaaagcactgttcggtcacgcggataacatcatctatacctcgacattt
tccaaaatcctggcaccgggcctgcgtctgggctgggtgattatgcctgactggttgctg
cataaagtcgccatcatcaaacaggcggcggatctgcatgccagcgcgttgtcgcagacc
attgcggaatattatctcggtctgggccgtctgccgaaacagatcgaaaccatccgtgcg
gcgtataaaaacaaatgtcagatcatggccggattgctggagcgcgagctgggtgacgtg
ctgacgtttgaatatccgaaaggcggcatgttcctgtgggcgcgcttccgcgagccgcgt
aactgcgctgagtggatgaaaaagacgcttgagcagggcgtggtgtttgtaccgggtgaa
ttcttctatgccgataatccggatcactcgaccttccgtttgtcattcgccaccgcgacc
gaagagcaaatgcatgaggccgttgcccgtctgaaacgcgcgctgtaa

DBGET integrated database retrieval system