KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4303Help
Entry
Rahaq2_4303       CDS       T01770                                 

Definition
(GenBank) ABC-type branched-chain amino acid transport systems, ATPase component
  KO
K01995  
branched-chain amino acid transport system ATP-binding protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
ABC transporters
Quorum sensing
Module
Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:raq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Rahaq2_4303
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Rahaq2_4303
Transporters [BR:raq02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Rahaq2_4303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4581167..4581937)
Genome map
AA seq 256 aa AA seqDB search
MSTQPLLAVEGLMMRFGGLLAVNNVALNLNQGEIVSLIGPNGAGKTTVFNCLTGFYKPSG
GTIKLRDQHLEGLPGQKIARMGVVRTFQHVRLFREMTVIENLLVAQHQHLKSGVLAGLFK
TPGFRRAEADALDRAADWLERVGLLELANRQAGNLAYGQQRRLEIVRCMVTRPEILMLDE
PAAGLNPRETEELNQLIAELRNQHNVSVLLIEHDMKLVMGISDRIYVVNQGTPLAQGTPA
EIRNNPDVIRAYLGEG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcaacctctgttagcggttgaagggctgatgatgcgttttggcggcctgctg
gcggtcaacaacgtggcgctgaacctcaatcagggcgaaattgtttccctgatcggcccg
aacggtgccggtaaaaccacggtatttaactgtctgaccggtttctacaaaccgagcggt
ggcaccattaaactgcgtgatcagcatcttgaaggattaccggggcagaaaattgcccgc
atgggcgtggtgcgtactttccagcacgtgcgcctgttccgcgagatgaccgtgatcgaa
aacctgctggtcgcacagcatcagcacctgaaaagcggcgtgctggcgggcctgttcaaa
acgccgggctttcgtcgtgccgaagcggatgcgctcgatcgcgcagccgactggctggaa
cgtgtcggactgctcgaactggcaaaccgtcaggcgggtaatctggcttacggtcagcaa
cgccgtctggaaattgtccgctgcatggtcacgcgtccggaaatcctgatgctcgacgaa
ccggctgctggcctgaacccgcgagaaaccgaagagctgaaccagctgatcgctgaattg
cgtaaccagcacaacgtgtcggtgctgctgattgagcacgacatgaaactggtgatgggc
atttctgaccgtatctatgtggtgaatcagggaacgccgctggcgcagggcacaccggct
gaaattcgtaataatcctgacgtgatccgcgcctatttaggcgaaggttaa

DBGET integrated database retrieval system