KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4306Help
Entry
Rahaq2_4306       CDS       T01770                                 

Definition
(GenBank) ABC-type branched-chain amino acid transport system, periplasmic component
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq02010  ABC transporters
raq02024  Quorum sensing
Module
raq_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:raq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Rahaq2_4306
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Rahaq2_4306
Transporters [BR:raq02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Rahaq2_4306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_6 ANF_receptor Peripla_BP_5 Fe-ADH Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: AEX54059
UniProt: H2IW04
Position
complement(4584361..4585473)
Genome map
AA seq 370 aa AA seqDB search
MKVTKGKIWLAGCIALAMSQAAFAKDIKVAIVGAMSGPVAQYGDMEFTGAKQAIADINAK
GGVKGDKLVGVEYDDACDPKQAVAVANKVINDGIRYVIGHLCSSSTQPASDIYEDEGVLM
ITPAATNADLTTRGYKMVMRTTGLDSDQGPTAAKYILDTIKPKRIAVVHDKQQYGEGLAR
SVQDALKKGGGNVVLFEGVTAGDKDFSTLVARLKKENVDFVYFGGYYPEMGQILRQSKQA
GLAAKFMGPEGVGNSSLSNIAGDASEGMLVTLPKRYDQVPANQPIVDALKAKKLDPTGPF
VWTTYAALQALTTGMERSGSMEPADIAKNLKSASVDTVMGPLSWDAKGDLKGFEFGIFEW
HKDGTSTPIK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaacaaagggtaagatctggctggcagggtgtattgccttagcaatgagtcag
gcggcgttcgcaaaagacatcaaagtcgccattgtcggtgctatgtcaggtccggtcgcc
cagtacggtgacatggaatttacgggtgcaaaacaagccatcgctgacatcaacgctaaa
ggtggcgtgaagggcgacaaactggttggcgtggaatatgacgatgcctgtgatccgaaa
caagccgttgccgttgccaacaaagtgattaacgacggtatccgttatgttatcggtcac
ctgtgttcttcttccactcagcctgcttctgacatctacgaagatgaaggcgtgctgatg
atcaccccggcggccaccaacgccgatctgaccacccgtggttataaaatggtgatgcgt
accaccggtctggattccgatcagggcccgaccgccgcgaaatacatcctcgacaccatc
aaaccaaaacgtattgccgtagtgcatgacaaacagcaatacggcgaaggcctggcccgt
tccgtgcaggatgcgctgaaaaaaggcggcggcaacgtggtgctgtttgaaggcgtgacc
gcaggtgacaaagacttctccacactggtggcgcgtctgaagaaagaaaacgtcgacttt
gtgtatttcggcggctactacccggaaatggggcagatcctgcgtcagtcaaaacaagcc
ggtctggcagccaaattcatgggcccggaaggcgtaggcaactcctcactgtctaacatt
gccggtgatgcgtctgaaggcatgctggtgaccctgccaaaacgttacgatcaggtgccg
gctaaccagccaatcgttgatgcgctgaaagccaagaaactggatccaaccggtccgttc
gtctggacgacttacgccgcattgcaggcgctgaccaccggtatggaacgcagcggcagc
atggaaccggctgatatcgccaaaaacctgaaatcagcgtcagtggataccgtcatgggc
ccgctgagctgggatgcaaaaggtgacctgaaaggattcgaattcggtattttcgagtgg
cataaagacggcacgtctaccccaatcaaataa

DBGET integrated database retrieval system