KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4313Help
Entry
Rahaq2_4313       CDS       T01770                                 

Definition
(GenBank) putative membrane protein
  KO
K08993  putative membrane protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1145
Motif
Other DBs
NCBI-ProteinID: AEX54066
UniProt: H2IWL7
Position
4591477..4591755
Genome map
AA seq 92 aa AA seqDB search
MLINIGRLLMLCIWGFLAFNLIHPFPKPIKYFLDVAIVFMFFMHGLQVMLLKATQGKEKD
TIGPWLQTRIFLFGVFELMAWQKKQPPLPSKK
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcaatattggtcggttgttgatgttatgtatttggggatttctggcgtttaac
ctgatccacccgttcccgaaaccgatcaaatactttttagacgtggcgattgtattcatg
ttctttatgcacggcctgcaggtgatgctgcttaaagccacacagggcaaggaaaaggac
accatcggcccgtggctgcaaacccgcatcttcctgttcggcgtattcgaactgatggcg
tggcagaaaaaacagccgccgctgccgtccaaaaagtaa

DBGET integrated database retrieval system