KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4317Help
Entry
Rahaq2_4317       CDS       T01770                                 

Definition
(GenBank) conserved hypothetical integral membrane protein
  KO
K09125  
uncharacterized protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4595598..4596269
Genome map
AA seq 223 aa AA seqDB search
MYSFTAQQRFSALIWLSLFHIAIITSSNYLVQLPVSIFGFHTTWGAFTFPFIFLATDLTV
RIFGAPLARRIILSVMVPALAISYAISALFFEAQWQGVEALNSLNIMVARIATASFMAYV
LGQILDVHVFNRLRQNRRWWIAPVASMFLGNISDTLSFFFIAFYKSSDAFMAQHWVEIAM
VDYTFKVLICLVFFLPMYGMLLNMLLKRLSAQGTSPHSAISAH
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtactcttttactgctcagcagcggttttccgcgctgatatggctttcgctattccac
atcgccatcatcacctccagtaactatctggttcagttgcccgtttccatctttggtttt
cataccacctggggcgcgttcactttcccgtttattttcctggccaccgatctgaccgtc
cgtatctttggcgcaccgctcgcacgacggatcattttgtccgtgatggtgcctgcgctg
gccatttcctatgccatctcggcgttattctttgaagcgcaatggcagggcgtggaagcg
ctcaacagcctgaatatcatggtcgcccgtatcgccaccgccagttttatggcctatgtg
ctggggcaaattctcgacgttcacgtgtttaaccgcctgcgccagaaccgccgctggtgg
atagctccggtcgcctcgatgttcctcggcaatatcagcgatacgctgtccttctttttt
atcgctttctacaaaagcagcgatgcctttatggcacagcactgggtggaaatcgcgatg
gtggattacacgttcaaggtgctgatctgtctggtgttcttcctgccaatgtacggcatg
ctgctcaatatgttgcttaagcgtttatcagcacaagggaccagcccgcattccgccatc
agcgcgcattaa

DBGET integrated database retrieval system