KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4319Help
Entry
Rahaq2_4319       CDS       T01770                                 

Definition
(GenBank) hypothetical protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4597186..4597878
Genome map
AA seq 230 aa AA seqDB search
MYHSDFIINTLANDEILAKKLDAAVTGVKEQILDQSHRIQDGATRLVYYTSCFTENYQDV
CAKLKREDIRFLESLQQLIKDRRIISDMIQIYVESLIKNRNQSQLHYIQRTLMKASVNIS
TSSLTTQSFALGITMSICLGFNIHTSFSQKIGKVSALAAAGIGFYGYVQEAAESAERLQV
LNPAYYYALYMRKLEMMYFLVEPLFMKAHSFSTNLTSDDEVAKTIIDMVK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtaccatagtgattttattattaatacgttggcgaatgatgaaatacttgcaaaaaag
ttggatgcagcggttaccggagttaaggagcagattctcgatcaatctcacagaattcag
gatggcgcaacaaggctagtgtattacacttcatgttttacggagaattatcaagatgtc
tgcgcaaagctgaaacgagaggatattcgattccttgagtctttacagcagttaattaaa
gacagaaggatcatatctgacatgatacagatttatgtcgaatcacttattaaaaataga
aaccaaagccaactacactatatccaacgcaccttaatgaaagcaagcgtaaatatatca
acgagttctctgacgacacaatcatttgcattaggcataacgatgtccatttgccttgga
ttcaatattcataccagcttcagccagaaaattgggaaggtgtccgcacttgccgctgcc
ggaataggcttttacggatacgtacaggaagctgcagagagtgcggaacgtttgcaggtt
ctgaatcctgcatattactacgcgttatatatgcgaaaattagaaatgatgtatttttta
gttgagcctctttttatgaaagctcactcctttagcacgaatcttacatcagatgatgaa
gtcgccaaaacaataattgatatggtaaagtga

DBGET integrated database retrieval system