KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4321Help
Entry
Rahaq2_4321       CDS       T01770                                 

Definition
(GenBank) ATPase component of ABC-type sugar transporter
  KO
K10111  
multiple sugar transport system ATP-binding protein [EC:3.6.3.-]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
ABC transporters
Module
Maltose/maltodextrin transport system
Putative multiple sugar transport system
arabinogalactan oligomer/maltooligosaccharide transport system
Brite
KEGG Orthology (KO) [BR:raq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Rahaq2_4321
Enzymes [BR:raq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     Rahaq2_4321
Transporters [BR:raq02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter [MD:M00194] [OT]
    Rahaq2_4321
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491] [OT]
    Rahaq2_4321
   Trehalose/maltose transporter [MD:M00204] [OT]
    Rahaq2_4321
   Putative sorbitol/mannitol transporter [MD:M00200] [OT]
    Rahaq2_4321
   Putative multiple sugar transporter [MD:M00207]
    Rahaq2_4321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4599852..4600928)
Genome map
AA seq 358 aa AA seqDB search
MSGLTLKNIKKYYDKTAVIPDLSLEIHSGEFLVLVGPSGCGKSTLLRMIAGLDALSDGTI
HIEDTDVTDLPAGKRGLSMVFQSYALYPHMTVRQNLAFGLKNIRTPPQEIARRISEAALI
LRLEDMLDRLPQNLSGGQRQRVAIGRSIVQQPKVFLFDEPLSNLDAALRVQMRQEISQLH
ARLKNTMIYVTHDQVEAMTLADRIVVLNKGHIEQIGTPVELYNCPASLFVAGFIGTPKIN
VIPARVEDRQLCIDGQPMFPLGDKYPSVQDGQTVSLAIRPELLRLNEVTDHAFGVLVDFT
ELQGDSTLVYARVGEHILKMKSSKQLSFAKNTPLRFGFNAASILLFDEAGRRILPDVA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtttaacgctaaaaaatatcaaaaaatactatgacaaaacggccgtgatcccc
gatttgtctctggagatccattccggtgagtttctggtgctggtcggtccgtcaggctgc
gggaaatcaacgttattgcgcatgattgccgggctggatgcgctgagcgacggaactatc
catattgaagatacggatgtgacggatttgcccgccggaaagcgcggtctgtcgatggta
tttcagtcctacgcgctttatccgcacatgaccgtcaggcagaacctggcatttggtctg
aagaatatccgcacgccgccgcaagaaatcgcccgacgcataagcgaagccgccctgatt
ttgcggctggaggacatgcttgaccgcttgccgcaaaacctttccggcgggcaacgtcag
cgcgttgccatcgggcgttccattgttcagcagccgaaagtgtttttgtttgatgaacca
ttgtcgaatctcgatgccgcgctgcgtgtgcagatgcgacaggaaatcagtcagcttcat
gcccgcctgaaaaacaccatgatttacgtgacccacgatcaggtcgaggccatgacgctg
gcggaccggattgtggtgcttaacaaaggtcacattgagcaaatcggcacgccggttgag
ctctataattgccccgccagtctgtttgtcgccggttttatcggtacgccgaaaatcaat
gtgatcccggcgcgggtagaagaccgccagttatgtattgacgggcagccgatgttcccg
ctgggagataaatacccgtcggtgcaggatggacaaacggtatcgctggcgatccgccct
gagctgttgcgcctcaatgaagtgacggatcatgccttcggtgtgttggtggatttcact
gagttgcagggtgattccacgctggtctacgcgcgcgttggcgaacatatcctgaaaatg
aagtcgtcgaagcagctctcttttgctaaaaacacgccgctcaggttcgggtttaatgcc
gccagtattttactgtttgatgaagcgggcaggcgcatcctcccggacgttgcgtaa

DBGET integrated database retrieval system