KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4323Help
Entry
Rahaq2_4323       CDS       T01770                                 

Definition
(GenBank) transcriptional regulator
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 Peripla_BP_4 LacI HTH_Tnp_ISL3 HTH_3 HTH_38 HTH_35 HTH_23
Motif
Other DBs
NCBI-ProteinID: AEX54076
UniProt: H2IWM7
Position
complement(4602378..4603412)
Genome map
AA seq 344 aa AA seqDB search
MCKLSKITLKSIARELGVTHTTVSNAFNNPGKLSESLRKRIIDYAHSVNFYGPDNIGRAL
RTGRSDAIGIIFNDTLSYVFTDSHDVQLMQGIAGECDRKGVSIILIPLHNGQGARASVIN
TAVDGYILNATHNNDQIIAKALSKNLPVVTTDFKIPPHSSVSIDNYRAMREICLHLLEKG
HREFGIISFPSLQGRKGIVPLSQDISGDNDVMITRVKSCVETFREWNIELDNCFLCETSH
HETFGEIAAQELLNVNPGITAFICLSDRFAQGAINYCRQSGLRVPQNIAITGFDNIPRPE
NEIGLTTISQDPVRKGEIAAALLLEGKNNIHFDLEFTLIIRGST
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtaaactgagtaagataaccttaaaatcaattgcccgtgaattgggggtgacgcac
acgacggtgtcgaatgcatttaataacccggggaagttatctgaatccttaagaaagcga
ataattgattacgctcattccgttaatttctacggacccgataatatcgggcgcgcatta
cgtaccggcaggtcggacgcgattggcattatcttcaatgacacgctgagttatgttttt
actgacagccatgacgtgcaactcatgcagggcatcgccggtgaatgtgaccgcaaaggt
gtcagcatcatcctgatcccattgcataatggacagggcgcgcgggccagtgtgattaac
acagcggtagatggttatatccttaatgcgacacacaataatgaccagattatcgctaag
gcattatcaaaaaatctgccggtggtgaccacggattttaaaattcccccgcacagcagt
gtctccattgataactaccgggcgatgagggaaatttgcctgcacctgctggaaaaagga
caccgtgaattcgggattatttcatttccttcactgcaggggcgtaagggtatcgtgcca
ttgagtcaggatatttcaggtgataatgacgttatgatcacccgggtgaaatcttgtgtg
gagactttccgcgaatggaatatcgaactcgataattgctttctttgtgaaacaagccat
cacgagacgtttggcgaaatagcggcgcaggaattacttaacgtaaacccgggaataacc
gcgtttatttgcctgtctgaccgctttgcgcaaggcgcgattaattattgccggcagtcc
gggttacgggttccgcaaaatatcgcgattaccggatttgataatattccccggccagag
aatgaaatcgggctcactaccatttcccaggatcccgttagaaaaggtgagatagccgct
gccttgctgctggaggggaaaaataatattcacttcgaccttgagtttacgttaattata
cgtggttctacctga

DBGET integrated database retrieval system