KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4325Help
Entry
Rahaq2_4325       CDS       T01770                                 

Definition
(GenBank) permease component of ABC-type sugar transporter
  KO
K02025  
multiple sugar transport system permease protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Module
Putative multiple sugar transport system
Brite
Transporters [BR:raq02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    Rahaq2_4325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4604945..4605814
Genome map
AA seq 289 aa AA seqDB search
MIKIKESSLGGLLASTYLGYSLVFWLYPFLWLAVLSFTDWKFIGVPSFNGVKNIISVMQN
PLFWTSVYNVFKFLAYYLPIVFVSSLLFAFGLRKIKYGKAFVALSFLLANVSSGVAYSIV
FSKLFSETGPINTFLMDIFGINVPWFTHPDFAMLSIALIITWKFVGYYGLIFYSGLITIP
KDIYDAADLDKTTGLGKIWHITLPLMNAQIVMVLVLAITVAFSIFTEPYLITGGGPLEST
TTPMVVMYEAAFRQMQPSWAATMSIIVALFSFSLIWILRRCLEKKIEIV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaatcaaagagtcatcactgggaggccttctggcctccacttacctcggatat
tcgctggtattctggctttatccttttctctggctggcggtactgagttttactgactgg
aaatttattggcgttccgtccttcaacggggtaaaaaatattatttccgtcatgcagaac
cctttattctggacgtcggtttataacgtatttaaatttctggcttactatctgccgata
gtttttgtttcttcactattgttcgctttcggactaagaaagataaaatacggtaaagcg
tttgttgccctgagtttcctgctcgccaatgtttcatccggcgtggcgtattccattgta
ttttcgaaactgttcagtgaaacagggccgatcaacacgtttctgatggacatatttggc
attaatgttccgtggtttactcacccagatttcgccatgttatctattgcccttattatc
acctggaaatttgtcggttattatggcctgattttttattccgggctgattactattccc
aaagatatttacgatgccgccgatctcgataaaaccacgggcctcggaaaaatatggcat
atcacattgcccctgatgaatgcccagatagtcatggtgctggttctcgcgattacagtc
gcgttcagtatttttaccgaaccttatctcatcaccggcggtggcccgctggaaagcacc
accacgcctatggtggtcatgtatgaggccgccttccggcagatgcagcccagctgggcc
gcgaccatgtctattattgtcgccctgttcagtttctcactgatctggatattgcgccgg
tgtctggaaaagaaaatcgagatcgtatga

DBGET integrated database retrieval system