KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4328Help
Entry
Rahaq2_4328       CDS       T01770                                 

Definition
(GenBank) putative glycosylase
  KO
K20885  
beta-1,2-mannobiose phosphorylase / 1,2-beta-oligomannan phosphorylase [EC:2.4.1.339 2.4.1.340]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
Enzymes [BR:raq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.339  beta-1,2-mannobiose phosphorylase
     Rahaq2_4328
    2.4.1.340  1,2-beta-oligomannan phosphorylase
     Rahaq2_4328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4608236..4609303
Genome map
AA seq 355 aa AA seqDB search
MKMLRSDKNPLLTPADVTPSQPGWKVDCVFNAGVCSYQGETLLLLRVAESVLSTDANCLE
VPLLVNQQSAWRAGTKRFRRDDPAYDFSDPRMIALKADPSVIWLTSMSHLRLARSHNGED
FSVDTQPFLTADTQYEQFGCEDPRITLIDGVYYINYSAISPYGISTALATTTDFVTVEKQ
GVIFCPDNRDVCFFPEKINGKYQALTRPSPKHFGKPEIWMCESPDMLHWGNHRHLLGSAS
GDWDALKLGGGAPLIKTVRGWLQIYHGVDKDQRYCLGAMLLDLNNPFNILAKSSVPLLQP
EAIYEKEGFFGNVVFTCGALLEGDLLKIYYGAADECIALATMPLDALWVHLGMPL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgctcagaagtgataaaaacccgctgttaacacctgctgacgttactccttcc
cagcccggctggaaggtcgattgtgtttttaacgcaggcgtatgttcatatcagggagaa
accctgctgctgcttcgtgtcgcggaaagcgtgctctcaaccgacgctaattgtctggaa
gtgccgcttctggtaaatcagcaaagcgcctggcgggcgggcacaaaacgttttcgtcgc
gatgatccggcctatgatttcagtgaccccagaatgattgcactgaaagctgacccttcg
gtgatctggctgacctccatgtcacatctgcgtttagcgcgcagtcacaacggcgaagat
tttagtgttgatactcagccctttttgaccgctgatacgcaatacgaacaatttggctgt
gaagatccacgaattacgctgatcgatggcgtttactacatcaattattcggccatttcg
ccgtatggcatttccaccgcgctggcgaccaccaccgattttgtcactgtggaaaaacaa
ggcgtgattttctgccccgataaccgcgatgtctgcttcttcccggaaaaaattaacggc
aaatatcaggccctgacccgtccttcacccaaacattttggcaagccggagatctggatg
tgtgaatcaccggacatgctgcactggggcaatcatcgccatttgctcggcagtgcttcc
ggcgactgggatgcgctgaaactgggcggtggcgcaccgctgataaaaacggtgcgcggc
tggttgcagatttatcatggtgtggataaagaccagcgttattgcctcggcgcgatgctg
ctcgatctgaataatccgttcaacatcctcgccaaatcttcagtgccgctgttacaaccg
gaagcgatatatgaaaaagaaggattctttggcaacgttgtctttacctgcggcgcattg
ctggagggagacctgttgaaaatttattacggggcagccgatgagtgcattgcactggca
acaatgccgctcgatgccttatgggttcatcttggaatgccgctgtga

DBGET integrated database retrieval system