KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4332Help
Entry
Rahaq2_4332       CDS       T01770                                 

Definition
(GenBank) hemolysin activation/secretion protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ShlB POTRA_2 POTRA_3
Motif
Other DBs
NCBI-ProteinID: AEX54085
UniProt: H2IWN6
Position
4613083..4614675
Genome map
AA seq 530 aa AA seqDB search
MAGVIISGVAAPLNPADRDLIRQEQQELLRQSQQQRDDLQRSLSPVSPVELHIEESNTLC
FYIHKIYINNATLLSDKEQQEINSPHLNQCIGMSRIAEITRQISDWYIHQGYITSRAFIS
EQDLSQGELHISVLEGRLEKITLEGDSSSQLTMAFPGLEGGILNLRDIEQGMEQINRLRS
NPVQIDILPAKKSGYSIVNLTATPESPLSASLSFDNSGQKSTGTGQLSGSLTAGNVLGMA
DKWFVSGGRSSDGATSHDAQNVQAGLSIPYGYNLVDYSYSWSNYLSTIDNNGFGWASTGD
SVTHRLTASRVLFRNGDIKTGASIGLTHQISNNSLNDVLLDSSSRKLTSLLFGLNHTQKI
LGGVATFNPTFSHGVSWLGAEDDNGKNDDLPKAGFKKWSLNGSFQLPVAEDLWWLTSFYG
QWSPDRLYGSERLTLGGESSVRGFKEQYLSGDNGGYWRNELNYRLFTLPFIGQVSSVVAL
DGGWLQKDNKDPWASGTLWGGRRRAFHHKSLLLQPVHRGHTIAISGLVSA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgtcattatatccggcgttgcggcccccctgaatccggccgaccgtgacctg
atccgtcaggaacaacaggaattattaaggcagagccaacaacaacgtgatgatctgcaa
cgcagtctttctcccgtttcacccgtcgaattacacatagaagaaagcaataccctctgt
ttttacattcataaaatatatataaataacgcaacacttctttctgataaagaacagcaa
gagattaatagccctcatcttaatcaatgtataggaatgagcagaattgcggaaataacc
cgtcaaatctctgactggtatattcatcagggatatataaccagccgcgcatttatctct
gaacaggatttatctcagggagaattacatatttcggtgctggagggacgtcttgaaaaa
atcaccctcgaaggcgattcatcttcacagctcaccatggcttttccggggctggaaggc
ggtattcttaatctgcgtgacatcgaacagggcatggagcaaatcaaccggttacgcagt
aatccggtgcaaatagacattcttcccgccaaaaaatccggctattccattgttaatctc
accgccacgccggaatcccctctcagtgcctcgttgagttttgataacagcgggcaaaaa
agtaccggtaccgggcagcttagcggctcgctgactgccggtaacgttctgggcatggcg
gataaatggttcgtcagcggcggacgcagcagcgacggggccacctcgcatgacgcacag
aacgtacaggccggactcagcattccttacggctataacctggtcgattacagctacagc
tggagcaactacctcagcacgatcgacaacaatggctttggctgggcatccaccggcgac
agcgtcacccaccgtttaaccgcctcgcgggtgctatttcgcaacggcgatatcaaaacc
ggtgcttcgatcggactgacacatcagatcagcaataactctctcaatgatgtgttgctt
gacagcagcagccgcaagctgaccagcctgctgtttggcctgaaccacacgcaaaaaatc
ctcggcggcgtcgcgactttcaaccccacattcagccatggcgtgtcctggctgggtgcg
gaagacgataacggcaaaaacgatgatttgccgaaagccgggtttaaaaaatggagcctg
aacggcagctttcagttgccggtggctgaagatttatggtggctgaccagtttctacggt
cagtggtcgccggacaggctgtatggcagcgagcgtctgaccctcggtggcgaaagctcg
gtgcgcggctttaaagagcaatatctttccggcgataacggcggttactggcgtaacgaa
ctgaactacagactgttcacattgccgtttatcggccaggtcagcagcgtggtggcactc
gatggtggctggctgcaaaaagataacaaagacccatgggcatccggcaccctgtggggg
ggccgccgtcgggctttccaccacaaatcgttattactccagccagttcaccgtgggcac
accattgcaatatccggactggttagcgcctga

DBGET integrated database retrieval system