KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4334Help
Entry
Rahaq2_4334       CDS       T01770                                 

Definition
(GenBank) putative hemagglutinin (DUF638)
  KO
K15125  filamentous hemagglutinin
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
Glycosaminoglycan binding proteins [BR:raq00536]
 Heparan sulfate/Haparin
  Microbial pathogens (General comment) Adhesion of microorganism to host cells
   Rahaq2_4334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fil_haemagg_2 PT-VENN
Motif
Other DBs
NCBI-ProteinID: AEX54087
UniProt: H2IWN8
Position
4616068..4618248
Genome map
AA seq 726 aa AA seqDB search
MSITATGGDITAIGSQIKAGLDVALNAADDISLISSQNTQWLEGENSSSGGAIGMGIGMG
KDGAGINISASGNASRGSESGNGTQHNETTIDAGNRISINSGDGTTIAGAQVSGNSVVAD
IGGDLILSSLQDSDYYDSSQQSISGGASFSFGTMTGSGSISASHDGMDSDYNSVTEQSGI
YAGDGGFDITVGGHTQLDGAVIASTGSADKNHLDTGTLGFSDIGNKAEYSTGHQGAGIST
GGTVAENFIGNMANGVLVGAGGEGEASGTTKAAISAGTITIRDRENQQQDVADLSRDVEH
ANGSISPIFDKEKEQKRLEIAQALGDVGSQAADIARTAGEIKGLEKAKAAHPELSGKALL
ETKEYKDTQKQYGTGSDIQQGISAATMALQGLAGGDMAAALAGGAAPYLAEQIKKQVGED
NVAANAIAHAIVGGVIAELQGRDAAAGAAGAATGELIAQVLYPGVKHEDLTETEKQKVVA
LSTLAAGLAGGLAGDDTAGVIAGAQGGKNATEYNHFNLPSGMMDYMDTAGSWNQFAVDNN
LSPEQIQAGLDKIAKGDLPEGANITKAIVEGYQDGVLTGAAIYLGPAAMTGKAIAGGVLA
WSANSGYQYYDLDQPGNENKSWDYKASAASFAAGMLAPGRGVIVNTSIGMGGAWFADGLD
GASQAGAAFGGLAGGTFGKLAPVVTDRVIGKDLPGFIYDFSGGMIFEFTNGAIKDTSKKD
NQQVGQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgataaccgccacgggcggcgatatcaccgctatcggcagccagattaaagccggg
ctggacgtggcgctgaacgcggcagacgacatcagcctgatttcctcgcagaacacacag
tggctggaaggagaaaacagcagcagcggcggcgcgataggaatgggcatcggcatgggc
aaggacggtgccgggattaacatctccgccagcggcaacgcctccaggggcagcgagagc
ggtaacggcacgcagcataacgaaaccaccatcgacgcgggcaaccgcatcagcattaac
agcggcgacggcacaacgattgccggtgcgcaggtgagcggcaacagcgtggtggcggat
atcggcggcgacctgatcctcagcagcctgcaggacagcgactattacgacagcagccag
cagagcatcagcggcggggccagcttctccttcggcaccatgaccggctccggcagcatc
agtgccagtcacgacggcatggacagcgactacaactcggtcactgagcagtccggaatt
tatgccggtgacggcggttttgatatcacggtcggcgggcatacccagctcgatggcgcg
gtaattgccagcacagggtcggcggataaaaaccaccttgataccggtacgctgggcttc
agcgacatcggcaataaagcggaatacagcaccggacatcagggcgcgggcatcagcacc
ggcggaactgttgcagagaactttatcggcaatatggcgaacggcgttctggtcggcgca
ggcggtgaaggtgaggcatcaggcaccaccaaagcagcgatttccgcaggaaccatcacc
atccgcgacagggaaaaccagcagcaggacgtggctgatttaagccgtgacgtggaacat
gccaacggcagcatcagcccgatatttgataaggagaaggagcagaagcggctggaaatc
gcgcaggcgctgggcgacgtaggcagccaggcggcagatatcgcccggacggcgggcgag
attaaagggctggaaaaagcgaaagctgcgcacccggaactgagtggcaaagcactgctg
gagacaaaagagtacaaagacacccagaaacagtacggcaccggcagcgatatccagcaa
ggtatcagcgcggcaacgatggcgcttcaagggctggcgggcggtgatatggcagcagca
ctggcaggcggtgcggcaccgtatctggcagagcaaatcaagaaacaggtcggcgaagat
aacgttgccgccaatgccatcgcccacgccattgtcggcggtgtgatcgcagagcttcag
ggacgtgacgccgcagcaggcgcggcaggcgcagccaccggtgagctaatcgcccaggtg
ctttatccgggcgtgaagcatgaagacctgacggaaacggaaaagcagaaagtcgtggca
ctgagcacgctggcggccgggctggctggcggacttgccggggatgatacggcgggcgtt
attgccggtgcgcagggtgggaagaatgcgacggaatacaatcactttaatctgccctca
gggatgatggattatatggatacagcaggctcgtggaatcagtttgcggtagataataat
ctctcgcccgaacagatacaggccgggctggataaaatagcgaaaggagatttgccggaa
ggagcgaatatcaccaaagcgatagtcgaaggttatcaggatggcgtattaacaggcgcg
gcgatatatctggggcctgctgctatgacaggtaaagctattgccggtggggtgctggcc
tggagcgcaaacagtggttatcagtattatgacctggaccagccgggtaatgaaaataag
tcatgggattataaagcgagtgcggcatcattcgcggccgggatgctggcaccggggcgg
ggagtcatagtgaataccagtatcggtatgggtggagcctggttcgcggacgggctggac
ggtgcttcacaggcgggagcagcctttggtgggttggcgggtggaacgtttggaaaattg
gctcctgtagttacagatagagtgataggtaaagatttacccggttttatttatgatttt
agtggtggaatgatttttgaatttactaatggagctattaaggatacatcaaaaaaagat
aatcagcaggtagggcaatga

DBGET integrated database retrieval system