KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4338Help
Entry
Rahaq2_4338       CDS       T01770                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rahaq2_4338
Enzymes [BR:raq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rahaq2_4338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4619673..4620665)
Genome map
AA seq 330 aa AA seqDB search
MPVNFAKWLTREKEFSAFATGPLLDFWRTREEGEFSGVDDVPIRYVRFCSPAHDKVIVVS
PGRIESYVKYPEVAYDLFHCGYDVMIVDHRGQGRSGRMLDDPHCGHVKHFDDYVEDFESF
YQLEIAPRQYVKKFALAHSMGGAILALFLAKNPGKFDAAALLAPMTGIYLPMPGWISRRI
LNWAENRPLRRDGYALGTGHWRPLPFVVNRLTHSRERYRRNLRFYADYPELQVGGPTYHW
VREGIEAGMHILKEAEKITTPVLLLQASEDRVVDNRSHLAFCQAMAVAGHPCEGEKPRVI
EGARHEILFERDDLRAQALDAIMRFFARQN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgaattttgcgaagtggttaacacgagagaaggagttttccgcctttgcgacc
ggacctttgctggatttctggcgtacgcgcgaagaaggcgagtttagtggcgttgacgat
gtcccgatccgctacgtccggttctgttcccccgcgcatgataaagtcatcgtggtgtca
ccggggcgtatagaaagctacgtaaaatatcctgaagtggcctacgatttattccattgc
ggctatgatgtcatgattgtcgatcaccgtggtcaggggcgctccgggcgaatgctcgac
gatccgcattgtggtcacgtgaagcactttgatgattatgtcgaagattttgaaagtttt
tatcagctggagattgccccacgtcagtacgtgaaaaagttcgcgctggcacactccatg
ggcggtgcaattctggcgctgtttctggcgaagaatccgggcaagtttgatgcggcggcg
ttgctcgcgccgatgaccggtatttatttgccgatgccgggctggatttcccgccgcatc
ctcaactgggcggagaaccgtccgctgcgccgcgacggttatgcgctcggtaccggccac
tggcggccattaccctttgtggtcaaccgcctgacacacagccgtgaacgttatcgccgt
aatctgcgattttatgccgattacccggagttgcaggtcggcgggccaacctatcactgg
gtgcgtgaagggattgaggcggggatgcatatcctgaaagaagctgaaaaaatcaccact
cctgtactgttattgcaggcgagcgaagaccgtgtagtggataaccggtcccaccttgct
ttttgtcaggccatggctgttgcggggcacccttgtgaaggggaaaaaccgcgggtcatt
gaaggcgcgcgccatgagatcctgtttgaacgggacgacctgagggcacaggcgctggac
gctatcatgcgcttttttgcgcgacagaattaa

DBGET integrated database retrieval system