KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4345Help
Entry
Rahaq2_4345       CDS       T01770                                 

Definition
(GenBank) membrane protein AbrB duplication
  KO
K07120  uncharacterized protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AbrB
Motif
Other DBs
NCBI-ProteinID: AEX54097
UniProt: H2IWP8
Position
complement(4626633..4627667)
Genome map
AA seq 344 aa AA seqDB search
MGQWFILVVSSLLLGIIFQTFHVPAALLLGPMIVGVVMGLTGASVRIHPLFFKISQGILG
CMIAQSLSPSILPPLLNDWPLVLMVLVATLLASGLSGWLLVRFSQLPGPTGAWGSSPGGA
SAMVAMAGDFGADVRLVAFMQYLRVLFVATAAAFVARMAMGDSASLAAAVVWFPPLTWRF
FATLFLAVAGVWLGPRLRIPSGALLLPAMVGAVLHSTGTVALEVPEWLLAMAYTLIGWSV
GLRFTSPIFKLALRTLPQMIASIIGLMLICGGMAWVLTKLLHVDMLTAYLATSPGGLDTV
AIIAAGSHADLGFVMAMQTLRLITILVTGPAMARFISRSASSSS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtggggcagtggtttatcctcgtcgtttcctcactgcttctgggcattatttttcaaacc
ttccacgttcctgctgcgcttttgctcgggccgatgattgtcggcgtggtcatgggattg
acgggggccagcgtgcgtattcatccgctgtttttcaaaatatctcagggtattttgggc
tgtatgatcgcgcaaagtctgtcgccttccattctgccgccgttacttaatgactggccg
ctggtactgatggtgctggtagccacactgctcgccagcgggctttccggctggctgctg
gtgcgttttagccagttgcccggtccgaccggcgcgtggggttcatcgcctggcggtgcc
agtgccatggtcgcgatggccggtgatttcggtgcggatgtccgtctggtcgcgttcatg
caatatctgcgcgtgttgtttgttgccacggctgccgcatttgtcgcccgcatggcgatg
ggcgacagcgcgtcgctggcggcagcggtagtctggttcccgccgctcacctggcgtttc
tttgccacgctatttctggcagtggccggtgtctggctggggccgcgcctgcgtatccct
tccggcgcgctgctgcttccggccatggtcggcgcggttttgcattccaccggaacggtc
gcgttagaagtgccggaatggctgctggcgatggcgtacacgctgattggctggagtgtc
gggctgcgcttcacgtctccgattttcaaactggctttgcgtacgctgcctcagatgatt
gcctcaattatcgggctgatgctgatttgcgggggaatggcgtgggtgctgaccaaactt
ctgcacgtcgatatgctgacggcttatctggccaccagcccgggcgggctggacaccgtg
gcgattattgcggcgggcagtcatgcggatttaggttttgtgatggcgatgcagacattg
cgtctgatcaccatcctggtaaccggccccgcgatggcgcgctttatctcacgcagcgcg
tcttcctcgtcttaa

DBGET integrated database retrieval system