KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4354Help
Entry
Rahaq2_4354       CDS       T01770                                 

Definition
(GenBank) adenylate cyclase
  KO
K05851  
adenylate cyclase, class 1 [EC:4.6.1.1]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rahaq2_4354
Enzymes [BR:raq01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Rahaq2_4354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4635562..4638120)
Genome map
AA seq 852 aa AA seqDB search
MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYQLLPVFLHQHHPLMPGYLEGKVPHG
ICVFTPDESQQTYLTDLEDKWGSALEPLLKGELPITGVYSMGSTSSIGQSQSSDLDVWVC
HQSWLDNEERNRLQQKCSLLEKWAASLGVEVSFFLIDENRFRHNESGSLGGEDCGSTQHI
LLLDEFYRTAVRLAGKRILWNMVPGEEEAHYDEYVLSLYAQGALTPNEWLDLGGLSTLSA
EEYFGASLWQLYKSIDSPYKAVLKTLLLETYSWEYPKTQLLAMDIKQRLHQGEIVCFGLD
SYCMMLDRVTRYLTQIEDFTRLDLVRRCFYLKVCEKLSRARASVGWRREILSQLVAEWGW
DEERLAMLDNRANWKIERVREAHNELLDAMMQSYRNLIRFARRNNLSVSASPQDIGVLTR
KLYAAFEALPGKVTLVNPQISPDLSESDLTFIHVPIGRANRTGWYLYNQSPSMESIVSHQ
PLEYNRYLNKLVAWAYFNGLLTSTTRLHIKSGSLCDIAKLRELVADVSHNFPLRLAAPTP
KALYSPCEIRHLAIIVNLEHDPTAAFRNQVVHFDFRKLDVFSFGQNQQCMVGSIDLLYRN
SWNEVRTLHFSGEQAVLEALKTILGKMHQDAAPPESVEVFCYSQHLRGLIRTRIQQLVSE
CIELRLSSKRLEPGRFKAVRVAGQTWGLFFERLSVSVQKLENAIEFYGAISNNKLHGLSV
KLQTDQAHLPAVIDGYASEGIIQFFFEDSSDDIGFNIYILDESNRVEVYHHCEGSKEDLV
RDVSRFYSSSHDRFTYGSSFINFNLPQFYQIVSLDDRIQVIPFRSNALSAACATLPESDA
EPSRLKQQFQLH
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
ttgtacctctacatcgagacattgaagcaaagattggatgcgatcaaccagttacgagtc
gatcgtgcgctggcagccatgggtcctgcgtttcaacaggtctatcagctgcttcctgtc
tttttacatcaacatcaccctctgatgccgggataccttgaaggcaaggttccgcatggt
atctgtgttttcacgcctgatgaatcccaacaaacctacctgactgaccttgaagataaa
tggggcagcgcgctcgagcctctgctgaaaggtgaattgccgatcaccggcgtatattcc
atgggcagcacctcttctatcggccagagtcaaagctctgatctggatgtttgggtttgc
catcagtcatggctcgataacgaagaacgcaaccgcctgcagcaaaaatgcagcctgtta
gaaaaatgggccgcctcgctgggcgtagaagtcagcttcttcctgatcgacgaaaaccgc
ttccgccacaatgaaagcggcagcctgggcggtgaagactgcggctcaacgcagcacatc
ttattactcgacgaattctaccgtaccgccgtccgcctggccggtaagcgtattctgtgg
aatatggtgccgggtgaagaagaagcgcattacgacgaatatgtgctttcgctgtacgcc
cagggcgcactgacgccaaacgaatggcttgatctcggtggcctgagtacgttgtcagct
gaagagtatttcggcgcgagtttgtggcagttgtataaaagtatcgattctccttataaa
gcggtgctcaaaacgctgctgctggaaacgtactcctgggaataccctaaaacgcaactg
ctggcgatggacattaaacaacgcctgcatcagggcgagatcgtctgcttcgggcttgat
tcctactgtatgatgctcgaccgcgtgacccgttatctcacccagatcgaagatttcacc
cgccttgatttagtccgccgctgtttctatttaaaagtctgcgaaaaactctcccgcgca
cgggcgtcggtcggctggcgtcgtgaaattctcagtcagctggtggcggaatggggatgg
gatgaagaacgtctggcaatgctggataaccgggcgaactggaaaatcgagcgtgtgcgc
gaagcgcataacgaactgcttgatgccatgatgcaaagctatcgcaacctgatccgtttt
gcccgtcgcaacaatttaagcgtcagtgccagtccgcaggatatcggcgtgctgacccgt
aagttgtacgccgcgtttgaagcgctgccgggcaaagtcacgctggtgaatccacagatt
tcccctgatctgtcagaaagcgatttaacctttattcatgtgccgattggccgtgcgaac
cgcaccggctggtatctgtataatcagtcgccgtcgatggaatctatcgtcagccatcag
ccgctggaatataaccgctatctgaacaaactcgtggcgtgggcctatttcaacggcctg
ctgacatccactactcgtctgcatattaaaagtggcagcttgtgtgatatcgctaaactg
cgcgaactggtggcggatgtctcgcacaacttcccgttgcgtctggcggcaccgacgcca
aaagcgttgtacagcccgtgcgagattcgtcacttagcgattatcgttaatctggaacat
gatccgaccgccgctttccgcaatcaggtggtgcattttgatttccgtaaactggatgtc
ttcagcttcgggcagaatcagcaatgcatggtcggcagtattgacctgctttatcgcaac
tcatggaatgaagtacgtacgctgcatttcagtggtgaacaggcggtgctggaagcgctg
aaaactattctgggcaaaatgcaccaggacgccgcgccgccggaatcagtggaagtgttc
tgctacagccagcatttacgcggccttatccgtacgcgaattcaacaactggtgtcggaa
tgcattgagcttcgcctgtcgagcaaacgcctcgaacctggtcgtttcaaagccgtgcgt
gttgcaggacaaacctggggattgttctttgaacgtctcagcgtttctgtgcaaaagctg
gagaatgcgattgaattttatggcgcgatttccaacaacaaactgcacggtttgtcggtg
aaattgcagaccgatcaggcgcatctgccggcagtgattgacggctacgccagcgaaggg
atcattcagttcttctttgaagacagttcggacgacatcggcttcaatatctacattctt
gatgaatccaaccgtgttgaggtttatcaccactgcgaaggcagcaaagaagatctggtg
cgtgatgtcagccggttctattcgtcttcccacgaccggtttacctacggctcaagcttt
ataaacttcaacctgccgcagttctatcagattgtatcgctcgatgaccggattcaggtc
atcccttttcgcagcaacgcgctctctgctgcctgcgccaccttgcctgaaagcgacgca
gaaccttcgcgtctgaagcaacaattccagttacattag

DBGET integrated database retrieval system